SecReT6
Protein ID: 482900863
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26670
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2732766..2733332 [-]
Producthypothetical protein (UCP028301)
NoteTssB
UniProt IDM9YIY6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-60, Aligned region: 18..169
Protein Sequence: 188 a.a.     [Download]
>gi|482900863|ref|YP_007898677.1| hypothetical protein (UCP028301) [Azotobacter vinelandii CA6]
MADIRKNSPQKDSGQKFVGRNRSPRVQIEYDVEIYGSDRKVQLPFVMGVMADLTGKQVEPLPELAERKFV
EIDIDNFDDRMESLKPRVAFGVPNTLTGDGQLLVDLTFEQLDDFSPAQVAHKIEPLRKLLEARTQLANLM
SYMDGKTGAEELIAQVLQDPALLETLATNPRVPREADQPVRDEQAQES
 
Nucleotide Sequence: 567 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2733332-2732766 Azotobacter vinelandii CA6, complete genome
ATGGCTGATATCCGCAAAAACTCGCCCCAGAAAGACAGCGGTCAGAAGTTCGTCGGACGCAATCGCTCGC
CGCGCGTGCAGATCGAGTACGACGTCGAAATCTACGGCTCGGACCGCAAGGTGCAGCTTCCCTTCGTGAT
GGGCGTCATGGCGGACCTGACCGGCAAGCAGGTCGAGCCCCTGCCGGAACTGGCCGAGCGCAAGTTCGTG
GAAATCGACATCGACAACTTCGACGACCGCATGGAGTCGCTCAAGCCGCGCGTGGCCTTCGGCGTGCCCA
ACACCCTGACCGGCGATGGCCAGTTGCTGGTCGACCTGACCTTCGAGCAACTGGACGACTTTTCCCCGGC
CCAGGTGGCGCACAAGATCGAGCCGCTGCGCAAGCTGCTGGAGGCGCGTACCCAGTTGGCCAACCTGATG
TCCTACATGGACGGCAAGACCGGCGCCGAGGAACTGATCGCCCAGGTACTGCAGGACCCGGCCCTGCTGG
AAACCCTGGCCACCAACCCGAGGGTGCCGCGCGAGGCGGACCAGCCGGTCCGCGACGAGCAGGCGCAGGA
ATCCTGA
 Primer design