SecReT6
Protein ID: 482900867
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26710
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2736924..2740541 [-]
Producthypothetical protein
NoteTssM
UniProt IDM9YJU1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.10E-98, Aligned region: 210..474
ImcF-related_N [PF14331], Evalue: 2.10E-98, Aligned region: 835..864
ImcF-related_N [PF14331], Evalue: 2.10E-98, Aligned region: 1058..1072
IcmF-related [PF06761], Evalue: 1.70E-91, Aligned region: 525..836
DUF1215 [PF06744], Evalue: 1.30E-33, Aligned region: 946..1065
Protein Sequence: 1205 a.a.     [Download]
>gi|482900867|ref|YP_007898681.1| hypothetical protein AvCA6_26710 [Azotobacter vinelandii CA6]
MNRLLDFLARALGLILGRQLWVLLGLAALVALIWLVGPLIAIDGYRPLQSDRLRLGLIAAMLMAWLMRVL
YRTWRSANLNAQLLNRVREPAEGAATTADPHLEELRSRFGEAAERLKGARFAAQGGSGWGRWLERISRQY
LYQLPWYLFIGAPGSGKTTALVNSGLDFPLADQFGKAAIRGVGGTRNCDWWFTNEAVLIDTAGRYTLQES
HREQDQKEWLGFVELLKKYRARQPINGVMLTVSTADLLSSDEQERTQHAVRLRQRLQELRAQLGIQFPVY
VLVTKIDLLSGFTEYFARFGREERSQVWGMTFPLEAVRAPDFDLRRAFADEYRLLLERLYAGLPERLQGE
QDPLQRELAYLLPQEFAGLQAVLERFLEQVFVESRFEANALPRGVYFTSGTQEGTVFDRVMGGIKRLLQL
GGGAHLPQVGEPGRSFFLRRLMQEVIFQEAALAGRNERWQRRQAWLRRAGHALVGVGVLALGLAWFNSYR
HNLRHVEEVLARVPAVAERIAGIKVDDRAPVGALMPVLDQLASLHASSRFDVDDPPLDHRFGLFQGDKLR
AAADGAYARALEDVLLPHLARRLEDGLRQARPDDVEYAYGALKAYLMLYEAQHYDADYLQAWLSFDIERG
LDGRLANDRREALRQHLARLLGGRAVSSPYARDDALVAQVRGRLLGHGFGERSYGSLKRALRHDERLTDF
NVAEVVGPQATLVFLRVSGASLGNGGVPGLFTYRGYWEVFAPRIEDDLVARSREESWVLGLPELERIDPQ
TLAKWVREVKRLYFDDYIREWEGYLADLRLRSGADLAQNIQIARALSAADSPLVKLMSAAAQETTLLRAG
EDDRRPAAEQARDRVGAAREALESLFGRPESSADPRPSATERPERVVDERFAALRHFTRPGEKGEPAPIQ
SVRDTLNELYIHLIATDTALRDGQTPPGDGVLNKVRADAGRLPLPFRNMLNELARVSDGNVSRVVHRQLG
QNVAANVGDFCRQAVDGRYPLAHGSARDISPNDFAQLFAPAGLMDEFFQKNLAGLVDTSVRPWRFKGEAG
GRAAYLQSFERAAVIRDVYFAGGGRTPSIRIELKPLRMDAGIAQILFDIDGQTLRYAHGPQVPVQVQWPG
PGGGNRVRLEASGPDGTSKVLLSEGPWALHRLFDRAALAPGGAPEQMIATFDIGGAKAVFQVTAGGVRNP
FRLAQLESFSCPRRS
 
Nucleotide Sequence: 3618 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2740541-2736924 Azotobacter vinelandii CA6, complete genome
ATGAATCGCCTGCTGGACTTCCTGGCGCGCGCGCTCGGCCTGATCCTCGGCCGGCAGTTGTGGGTCCTGC
TGGGGCTGGCGGCGCTCGTCGCGCTGATCTGGCTGGTCGGGCCGCTGATCGCCATCGACGGCTACCGGCC
GCTGCAGAGCGACCGGCTACGCCTGGGACTGATCGCGGCGATGCTGATGGCCTGGCTGATGCGCGTGCTG
TATCGCACCTGGCGCTCGGCGAACCTGAACGCGCAACTGCTCAACCGGGTGCGCGAGCCGGCGGAGGGCG
CCGCGACGACGGCCGATCCGCACCTGGAGGAATTGCGCAGCCGCTTCGGCGAGGCCGCGGAACGGCTCAA
GGGCGCCCGCTTCGCCGCGCAGGGCGGCAGCGGCTGGGGGCGCTGGCTGGAGCGCATCTCGCGGCAATAC
CTGTATCAACTGCCCTGGTACCTGTTCATCGGCGCGCCGGGATCGGGCAAGACCACGGCCCTGGTCAACT
CCGGGCTGGATTTCCCGCTCGCCGACCAGTTCGGCAAGGCCGCGATCCGTGGCGTCGGCGGCACCCGCAA
TTGCGACTGGTGGTTCACCAACGAGGCGGTGTTGATCGACACCGCCGGTCGCTACACCCTGCAGGAAAGC
CATCGCGAGCAGGACCAGAAGGAATGGCTGGGCTTCGTCGAGCTGTTGAAGAAGTACCGCGCGCGCCAGC
CGATCAACGGCGTGATGCTCACCGTCAGCACCGCCGACCTGCTCAGCAGCGACGAACAGGAGCGCACGCA
GCACGCCGTCCGACTGCGCCAGCGGCTGCAGGAGCTGCGCGCCCAACTGGGCATCCAGTTCCCGGTCTAT
GTGCTGGTGACCAAGATCGACCTGCTGTCCGGGTTCACCGAATATTTCGCCCGCTTCGGCCGCGAGGAGC
GCAGTCAGGTCTGGGGCATGACCTTCCCGCTGGAGGCGGTGCGCGCGCCGGACTTCGACCTGCGGCGGGC
CTTCGCCGACGAGTACCGGCTGCTGCTGGAGCGCCTGTACGCCGGTCTGCCCGAGCGCCTGCAGGGCGAG
CAGGACCCTCTCCAGCGCGAGCTGGCCTACCTGCTGCCCCAGGAGTTCGCCGGGCTGCAGGCGGTGCTGG
AGCGCTTCCTGGAGCAGGTGTTCGTCGAGTCCCGCTTCGAGGCCAATGCGCTGCCGCGCGGCGTGTATTT
CACCAGCGGCACCCAGGAAGGCACGGTGTTCGACCGGGTGATGGGCGGCATCAAGCGCCTGCTGCAGCTC
GGCGGCGGCGCGCATCTGCCACAGGTCGGCGAGCCGGGGCGGAGTTTCTTCCTGCGCCGGCTGATGCAGG
AAGTGATCTTCCAGGAAGCCGCCCTGGCCGGGCGCAACGAGCGCTGGCAGCGCCGCCAGGCCTGGCTGCG
TCGCGCCGGCCACGCGCTGGTGGGCGTCGGCGTGCTGGCGCTGGGACTGGCCTGGTTCAACAGCTATCGC
CACAACCTGCGCCATGTCGAGGAGGTGCTGGCCAGGGTGCCGGCGGTGGCGGAGCGGATCGCCGGGATCA
AGGTGGACGACCGGGCGCCGGTCGGCGCCCTGATGCCGGTGCTCGACCAACTGGCTTCGCTGCACGCCAG
CAGCCGCTTCGACGTCGACGACCCGCCGCTGGATCACCGTTTCGGCCTGTTCCAGGGCGACAAGCTGCGC
GCCGCGGCCGACGGCGCCTATGCCCGCGCGCTGGAGGACGTGCTGCTGCCGCACCTGGCGCGCCGCCTGG
AGGACGGCCTGCGCCAGGCGCGGCCCGACGATGTGGAGTACGCCTACGGCGCGCTGAAGGCCTACCTGAT
GCTGTACGAGGCGCAGCATTACGACGCCGATTACCTGCAGGCCTGGCTGTCGTTCGACATCGAGCGCGGC
CTGGACGGGCGGCTCGCCAACGACCGGCGGGAGGCGCTGCGCCAGCATCTGGCGCGGCTGCTGGGCGGTC
GCGCGGTCAGCTCGCCCTATGCCCGCGACGACGCGCTGGTCGCCCAGGTCCGCGGTCGCCTGCTCGGGCA
TGGCTTCGGCGAGCGCAGCTACGGCAGCCTGAAGCGCGCGCTGCGCCACGACGAACGCCTGACGGATTTC
AACGTGGCCGAAGTCGTCGGCCCGCAGGCCACCCTGGTGTTCCTGCGGGTCAGCGGCGCCAGCCTGGGCA
ACGGCGGCGTGCCGGGACTCTTCACCTATCGCGGTTACTGGGAAGTGTTCGCCCCGCGCATCGAAGACGA
CCTCGTCGCCCGTTCCCGCGAGGAGAGCTGGGTGCTGGGCCTGCCGGAGCTGGAACGCATCGATCCGCAG
ACCCTGGCCAAGTGGGTCCGCGAGGTCAAGCGGCTGTATTTCGACGACTACATCCGCGAATGGGAAGGCT
ACCTGGCCGACCTGCGCCTGCGCAGCGGCGCCGACCTGGCGCAGAACATCCAGATCGCCCGCGCCCTGTC
GGCGGCCGACTCGCCGCTGGTGAAACTGATGAGTGCCGCAGCGCAGGAGACCACCCTGCTGCGCGCGGGC
GAAGACGACCGGCGTCCGGCGGCCGAGCAGGCCAGGGACCGGGTCGGCGCCGCGCGCGAGGCGCTGGAAA
GCCTGTTCGGCCGGCCCGAATCGAGCGCGGACCCACGCCCGTCCGCCACCGAGCGTCCCGAACGGGTGGT
GGACGAGCGCTTCGCCGCGCTGCGTCACTTCACCCGGCCCGGCGAGAAGGGCGAGCCGGCGCCGATCCAG
AGCGTGCGCGACACCCTGAACGAGCTGTACATCCATCTGATCGCCACCGACACGGCCCTGCGCGACGGCC
AGACGCCGCCCGGTGACGGGGTGCTGAACAAGGTCCGCGCGGACGCCGGCCGGTTGCCGCTGCCGTTTCG
CAACATGCTCAACGAACTCGCCCGGGTATCCGACGGCAACGTCAGCCGCGTGGTGCACCGGCAGCTCGGC
CAGAACGTCGCGGCGAACGTCGGCGACTTCTGCCGGCAGGCGGTCGACGGCCGCTATCCGCTGGCGCACG
GCTCGGCGCGCGACATCAGCCCGAACGATTTCGCGCAGCTCTTCGCGCCGGCCGGGCTGATGGACGAGTT
CTTCCAGAAAAACCTCGCCGGCCTGGTGGATACCTCGGTGCGGCCCTGGCGCTTCAAGGGCGAGGCCGGC
GGCCGGGCCGCCTACCTGCAATCCTTCGAGCGCGCGGCGGTGATCCGCGACGTGTATTTCGCCGGCGGCG
GGCGCACCCCGTCGATCCGCATCGAACTCAAGCCGCTGCGCATGGACGCCGGCATCGCGCAGATCCTCTT
CGATATCGATGGCCAGACCCTGCGCTACGCCCACGGGCCGCAGGTACCGGTCCAGGTCCAGTGGCCCGGT
CCGGGCGGCGGCAACCGGGTGCGGCTGGAGGCCAGCGGGCCGGACGGTACCAGCAAGGTCCTGCTCAGCG
AAGGACCCTGGGCGCTGCACCGGCTGTTCGACCGGGCCGCCCTGGCGCCCGGCGGGGCGCCGGAGCAGAT
GATCGCCACCTTCGACATCGGTGGCGCCAAGGCGGTGTTTCAGGTGACCGCCGGCGGCGTGCGCAACCCT
TTCCGGCTGGCGCAACTGGAATCCTTCTCCTGTCCGAGGCGCTCATGA
 Primer design