SecReT6
Protein ID: 482900868
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26720
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2740538..2741830 [-]
Producthypothetical protein
NoteTssL
UniProt IDM9YIZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 47..252
DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 372..415
OmpA [PF00691], Evalue: 6.00E-15, Aligned region: 316..414
Lipase_GDSL_2 [PF13472], Evalue: 6.30E-05, Aligned region: 131..210
Protein Sequence: 430 a.a.     [Download]
>gi|482900868|ref|YP_007898682.1| hypothetical protein AvCA6_26720 [Azotobacter vinelandii CA6]
MGDTRMNLHADTFFDPLKPSASPAPERGDDGQEQSATPAQPIVSGGNPLVAAANPLLNLVPQIGGTPQHP
DPPQLRERLLDEIRQFEVRARAAGVPAETVMGARYCLCTTLDEAATLTPWGGGGVWSAHSLLVSFHNETW
GGEKFFQLLARLSQAPQEHIDLLELQYFCLMLGFEGRYRVLDQGRSQLEALKQRLLQLIRKVRGEYPAAL
SPHWHDPVAAPPRVRRSLPVWVGAALAALLCLGLFATFQWLLAGRSDAAFAAIDQLRLPRVLAVAPTPAA
PEPRLAKLLEAEIRDGLVRVSDEVDRSLVVLRGDGLFDSGAAQVIERFQPLLARIGDALNTTRGSVLVMG
YTDNVPIRGLRYASNWELSQARADTVKAQLQARLSDPGRVRAEGRGAADPVAPNDSPANRARNRRVEITL
LVPPGTEARP
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2741830-2740538 Azotobacter vinelandii CA6, complete genome
CTGGGCGATACGCGAATGAACCTGCACGCCGATACCTTCTTCGATCCTCTGAAGCCTTCGGCCAGCCCGG
CGCCGGAGCGGGGCGACGACGGCCAGGAGCAGTCCGCCACCCCGGCGCAGCCCATCGTCAGCGGCGGCAA
CCCGCTGGTGGCCGCGGCCAATCCGCTGCTCAATCTGGTGCCGCAGATCGGCGGCACCCCGCAGCATCCC
GACCCGCCGCAACTGCGTGAGCGACTGCTCGACGAAATCCGCCAGTTCGAGGTGCGCGCGCGCGCCGCCG
GCGTGCCGGCGGAGACCGTGATGGGCGCGCGCTACTGCCTGTGCACCACCCTGGACGAGGCCGCCACCCT
GACCCCCTGGGGCGGCGGTGGGGTCTGGTCGGCGCACAGCCTGCTGGTCAGCTTCCACAACGAGACCTGG
GGCGGCGAGAAGTTCTTCCAGTTGCTGGCGCGGCTGTCCCAGGCCCCGCAGGAGCACATCGATCTGCTGG
AGCTGCAGTATTTCTGCTTGATGCTCGGCTTCGAGGGCCGCTACCGGGTGCTGGACCAGGGCCGCTCGCA
GCTCGAAGCGCTCAAGCAGCGCCTGCTGCAGTTGATCCGCAAGGTCCGCGGCGAATATCCGGCCGCGCTT
TCACCGCACTGGCACGATCCGGTCGCGGCGCCGCCCAGGGTGCGCCGCAGCCTGCCGGTCTGGGTCGGCG
CCGCGCTCGCCGCCCTGCTGTGCCTGGGCCTGTTCGCCACCTTCCAGTGGCTGCTGGCCGGCCGTTCGGA
CGCGGCCTTCGCCGCCATCGACCAGTTGCGCCTGCCGCGCGTGCTCGCCGTCGCGCCGACGCCCGCGGCC
CCCGAGCCGCGCCTGGCGAAACTGCTGGAGGCGGAGATCCGCGACGGCCTGGTGCGGGTGAGCGACGAGG
TCGACCGCAGCCTGGTCGTGCTGCGCGGCGACGGCCTGTTCGATTCCGGCGCGGCGCAGGTGATCGAGCG
CTTCCAGCCCCTGCTGGCGCGCATCGGCGACGCCCTGAACACCACCCGCGGCAGCGTGCTGGTGATGGGC
TACACGGACAACGTGCCGATCCGCGGCCTGCGCTACGCCTCCAACTGGGAGCTGTCCCAGGCCCGCGCCG
ATACCGTCAAGGCGCAGTTGCAGGCGCGTCTCTCCGACCCCGGACGGGTGCGCGCCGAAGGGCGGGGCGC
CGCCGACCCGGTGGCGCCCAACGACAGCCCGGCCAATCGCGCACGCAACCGGCGGGTGGAAATCACCCTG
CTGGTGCCCCCCGGAACGGAGGCACGGCCATGA
 Primer design