SecReT6
Protein ID: 482900869
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26730
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2741812..2743179 [-]
Producthypothetical protein
NoteTssK
UniProt IDM9YFY4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-156, Aligned region: 30..454
Protein Sequence: 455 a.a.     [Download]
>gi|482900869|ref|YP_007898683.1| hypothetical protein AvCA6_26730 [Azotobacter vinelandii CA6]
MKFHSPISTIPAVLRQRVVWSEGMFLRPQHFQQLERYLEHYVQARCLPTQGFHWGWQQLEVDRQALALGK
VALLGGSGTMPDGTPFAFGGDDAPAALEIPADLKNQTLVLALPLWRAGASETGWSRDGEPAWSRYRVTDF
EVPDANSEPFGPALLQVGRLDLRLMTEAALNGDWQSLGLVRVLERRNDGQVLLDEEYIPPLLSATRHPVL
RGCLDELHGLLRQRGEALAERLAQPGRGGVAEVGDFLLLALVNRYTAVTWRARQAACVHPSRLFDEWLEL
ASELATHTHERRRPQVFPEYRHDALRDSFAPLMAELRRALSSVLEQHAIAIALQERGSGVCVAQIPSLEL
IREAGFVLAVHADVPAETLRARFPAQLKLGAVERIRDLVSLQLPGIGVRLLPVAPRQLPYHAGHSYFELE
KGSEFWKQLEKSGSLALHVAGEFPGLKMEFWAIRE
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2743179-2741812 Azotobacter vinelandii CA6, complete genome
ATGAAATTCCATAGTCCGATTTCCACGATTCCCGCTGTATTGCGCCAACGTGTGGTGTGGAGCGAGGGCA
TGTTTCTCCGGCCCCAGCATTTCCAGCAGTTGGAGCGTTATCTCGAGCATTACGTGCAGGCGCGTTGCCT
GCCCACGCAGGGATTCCACTGGGGCTGGCAGCAACTGGAAGTCGATCGCCAGGCGCTGGCGCTGGGCAAG
GTCGCCCTGCTCGGCGGGAGCGGAACGATGCCGGACGGCACGCCCTTCGCCTTCGGCGGCGACGATGCGC
CGGCGGCGCTGGAGATTCCCGCCGACCTCAAGAACCAGACCCTGGTGCTGGCGCTGCCGCTGTGGCGCGC
CGGGGCCAGCGAGACGGGCTGGAGCCGGGACGGCGAGCCGGCCTGGAGCCGCTACCGGGTGACGGATTTC
GAGGTCCCGGATGCCAACAGCGAGCCGTTCGGTCCCGCGCTCCTGCAGGTGGGACGGCTCGATCTGCGCC
TGATGACGGAAGCGGCCCTGAACGGCGACTGGCAGTCGCTCGGCCTGGTCCGCGTGCTGGAGCGGCGCAA
CGACGGCCAGGTGCTGCTGGACGAGGAGTACATCCCGCCGCTGCTCTCGGCCACGCGCCACCCGGTGCTG
CGCGGCTGCCTGGACGAACTGCACGGCCTGCTGCGGCAGCGCGGCGAGGCGCTGGCCGAACGCCTCGCCC
AGCCGGGACGCGGCGGCGTGGCCGAAGTGGGCGACTTCCTGCTGCTGGCGCTGGTCAACCGCTACACGGC
CGTGACCTGGCGCGCGCGCCAGGCGGCCTGCGTGCATCCCTCGCGACTGTTCGACGAGTGGCTCGAACTG
GCCAGCGAACTGGCGACCCACACCCACGAGCGGCGCCGCCCCCAGGTGTTTCCCGAGTACCGCCACGACG
CGCTGCGGGACAGCTTCGCGCCGCTGATGGCGGAGCTGCGCCGCGCCCTGTCCAGCGTGCTGGAGCAGCA
CGCCATCGCGATTGCCCTGCAGGAGCGCGGCAGCGGCGTGTGCGTGGCGCAGATCCCGTCGCTGGAACTG
ATCCGCGAGGCCGGCTTCGTGCTGGCGGTACATGCCGACGTGCCCGCCGAAACCCTGCGCGCGCGCTTTC
CGGCGCAGCTCAAGCTGGGCGCGGTGGAGCGCATCCGCGACCTGGTTTCGCTGCAACTGCCGGGCATCGG
TGTGCGCCTGTTGCCGGTGGCGCCGCGGCAACTGCCTTACCACGCCGGCCACAGCTATTTCGAGCTGGAG
AAGGGCAGCGAATTCTGGAAGCAACTGGAGAAGTCGGGAAGCCTGGCGCTGCACGTGGCCGGCGAGTTTC
CCGGTTTGAAGATGGAATTCTGGGCGATACGCGAATGA
 Primer design