SecReT6
Protein ID: 482900870
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26740
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2743176..2743754 [-]
Producthypothetical protein
NoteTssJ
UniProt IDM9YR23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-34, Aligned region: 35..170
Protein Sequence: 192 a.a.     [Download]
>gi|482900870|ref|YP_007898684.1| hypothetical protein AvCA6_26740 [Azotobacter vinelandii CA6]
MLLVLRDFVLPSVTGKFGFLPIGAPVPALLLVSGLLSGCGSTPPPLAPAIPYQLKLNAGGNINPDILGRP
SPIVVRVFELRSGGAFESSDFFSLQDKPELVLGRELIGVEQVTLYPGEVRYVTGAGSPDARNIGILAEYR
ELDAKRWRRLIGLPLPRQSNSWFFWRSSPDRLSLSVDINNDGVDFLPVAHKQ
 
Nucleotide Sequence: 579 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c2743754-2743176 Azotobacter vinelandii CA6, complete genome
ATGTTGCTTGTGTTGCGTGATTTCGTTTTGCCATCCGTCACGGGAAAGTTCGGATTCCTGCCGATCGGAG
CGCCCGTTCCGGCGCTCCTGCTGGTTTCCGGCCTGCTGTCCGGGTGCGGCTCGACGCCGCCTCCGCTGGC
CCCGGCGATACCCTATCAACTGAAGCTGAATGCCGGCGGAAATATCAATCCCGATATTCTCGGGCGACCG
TCGCCGATTGTGGTGAGAGTGTTCGAGTTGCGTTCGGGCGGTGCCTTCGAATCGAGCGACTTCTTCAGTC
TGCAGGATAAGCCGGAACTTGTCCTGGGCCGGGAGTTGATAGGCGTGGAGCAGGTGACCCTGTATCCCGG
AGAGGTGAGATATGTGACGGGAGCCGGCAGTCCGGATGCGCGGAATATCGGCATCCTGGCCGAATACCGG
GAGTTGGATGCCAAGCGCTGGCGACGCCTGATCGGCTTGCCATTGCCCCGACAGTCGAACTCCTGGTTTT
TCTGGCGAAGTTCGCCGGATCGATTGAGCCTGTCCGTGGATATCAATAACGATGGTGTCGATTTCTTGCC
GGTTGCACATAAACAATGA
 Primer design