SecReT6
Protein ID: 482900872
SecReT6 ID755
T6SS typei3
Gene symbol-
Locus tagAvCA6_26770
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]2744499..2746196 [+]
Producthypothetical protein
NoteFha
UniProt IDM9YJU6
KEGG IDavd:AvCA6_26770
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.00E-06, Aligned region: 27..94
Protein Sequence: 565 a.a.     [Download]
>gi|482900872|ref|YP_007898686.1| hypothetical protein AvCA6_26770 [Azotobacter vinelandii CA6]
MRLTVLEYGGEAPSPPLSMLFSAPGGTIGRGADNHLVLPDDTRQISRLQAVLQVGEAGAQLKNLSPVCPI
EINEKPLAQQEEHPLCAGDIVRIGAYLLRAETAAPAQPALAPPPAEPMAAFAEAETALSPPGADSPPGAP
MSETPAPREPAGDTSAAPSPPERAALAEEAPASGMDAAPAGRADGEAAPAGQPEAQPERDEVPASAAVPE
AFWENLIAEFARHPAPESLSPADEIQAPLASGQAETTVATEDTLAALNRIPVDPLALFDATPGEDPDALF
DDSPSALAGPPAIPLDIRPTGPVVAPQANRVAELNGHFQAPRVGPRREGPPATGAGPSARPDDPPGGAPT
GGDPAAHGKAKTTKDAAGAFREGAGLEASYALGDEQLHCAGRLLASLLGGTMALLSSRTIIKREVKADLT
LILERENNPLKLLPDANTVLKQMFGPPFPGFMAPEQAVDDAFHDLQAHQIGMLAGMRAALRQLLHKVSPA
LVEQQLGAPDWRERLLPGGRDSRAWAHYRNLHQAMLTALEEDFHTVFGQAFLAAYDAEVELYRQQCRRTA
CHRNA
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|482897536|ref|NC_021150.1|:2744499-2746196 Azotobacter vinelandii CA6, complete genome
ATGCGATTGACCGTACTCGAATACGGTGGAGAGGCGCCCAGCCCGCCACTGAGCATGTTGTTCAGCGCCC
CCGGCGGCACCATCGGGCGAGGCGCCGACAACCATCTGGTACTGCCCGACGACACACGACAGATCTCCAG
GCTGCAGGCCGTGCTGCAGGTGGGCGAGGCCGGCGCGCAACTGAAAAACCTCAGCCCCGTCTGCCCGATC
GAAATCAACGAAAAACCGCTGGCGCAGCAGGAGGAACATCCCCTGTGCGCCGGCGACATCGTGCGTATCG
GCGCCTACCTGCTGCGCGCGGAAACGGCCGCCCCCGCACAGCCAGCGCTCGCTCCGCCGCCGGCCGAGCC
GATGGCGGCGTTCGCCGAGGCCGAGACGGCGCTGTCCCCGCCCGGCGCGGATTCGCCCCCGGGCGCGCCC
ATGAGCGAAACGCCGGCGCCGCGGGAACCGGCCGGCGATACCTCGGCAGCCCCGTCGCCGCCCGAGCGCG
CGGCGCTCGCCGAGGAGGCGCCGGCCAGCGGGATGGACGCCGCGCCGGCAGGCCGCGCCGATGGCGAGGC
GGCGCCTGCCGGCCAGCCCGAGGCCCAGCCCGAGCGCGACGAGGTGCCCGCCAGCGCAGCCGTCCCGGAA
GCCTTCTGGGAAAACCTGATCGCGGAGTTCGCCCGGCATCCCGCGCCCGAAAGCCTGAGCCCCGCCGACG
AAATCCAGGCCCCCCTGGCTTCCGGGCAGGCCGAAACGACGGTTGCGACCGAAGATACGCTGGCCGCCCT
GAACAGGATTCCCGTCGATCCCCTGGCGCTGTTCGATGCCACTCCCGGCGAGGACCCGGACGCGCTTTTC
GACGACAGTCCCAGCGCCCTGGCCGGGCCGCCCGCCATCCCGCTCGATATCCGCCCGACAGGGCCCGTCG
TCGCGCCGCAGGCGAATCGCGTGGCGGAACTGAACGGCCACTTCCAGGCGCCCCGCGTCGGGCCACGCCG
GGAAGGGCCGCCGGCGACCGGCGCCGGCCCGTCGGCGCGGCCGGACGATCCGCCGGGCGGCGCTCCGACG
GGCGGCGACCCGGCCGCGCACGGCAAGGCGAAAACCACGAAAGACGCCGCCGGCGCCTTCCGCGAGGGCG
CCGGTCTCGAAGCCAGCTATGCCCTGGGCGACGAACAATTGCACTGCGCCGGGCGCCTGCTCGCCAGCCT
GCTCGGCGGCACCATGGCCCTGCTCTCCAGCCGCACCATCATCAAGCGCGAGGTCAAGGCCGACCTGACC
CTGATCCTTGAGCGGGAAAACAACCCGCTCAAGCTGCTGCCCGACGCAAACACGGTGCTGAAACAGATGT
TCGGCCCGCCGTTTCCGGGCTTCATGGCGCCGGAGCAGGCCGTGGACGACGCCTTCCACGACCTGCAGGC
GCACCAGATCGGCATGCTGGCCGGCATGCGCGCGGCCCTGCGGCAGTTATTGCACAAGGTCAGCCCCGCC
CTCGTCGAGCAGCAACTGGGCGCCCCCGACTGGCGCGAGCGGCTGCTGCCGGGCGGCCGCGACAGCCGGG
CCTGGGCGCACTACCGCAACCTGCACCAGGCCATGCTGACGGCGCTGGAGGAAGACTTCCATACGGTGTT
CGGCCAGGCTTTCCTCGCCGCCTACGACGCGGAGGTCGAACTCTATCGCCAGCAATGCCGCCGAACCGCC
TGCCACAGGAATGCCTGA
 Primer design