SecReT6
Protein ID: 487815985
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0137
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]17516..21061 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.90E-93, Aligned region: 509..825
ImcF-related_N [PF14331], Evalue: 5.40E-81, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.80E-38, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|487815985|ref|WP_001889451.1| type VI secretion protein IcmF [Vibrio cholerae V52]
MWKFIVGIVRRLKPTVVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAV
WGIWQWRKLQAFKSEQKREEQLRQDPIKVYELRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHF
VDWLDRTRSRRPLNGIVLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFT
RQISGLKEILQQFFQEALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNS
TVYFTQKLFTHIIYPEAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKV
NQYKEQFPTSRSLASQREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRF
LPLLMADTIVALNQAETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDY
AMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQVELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPV
FDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQSESVSELALIDSWVLGQSKTAQFSEADKQALREKIRD
LYVADYTNTWRAALNEIDVKYFNDINDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELL
KSPKYKVASMIETPFADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLV
NADPIYTLKRISSGLPKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNK
DVALADFEAFFAPNGTLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGIL
DVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGPRENVELIWPNTLRDSVVSKVTLIPTQTNMSPRSLQIQ
GPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEMIYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0137|:17516-21061
ATGTGGAAATTCATTGTTGGAATAGTAAGGCGGCTTAAACCCACGGTGGTGGCAGCACTTCCCATTTTGC
TATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAGGCCCTTGGTTGGAAGTGGCTGGTTA
TAAACCGCTGGAGTCGATCATGGCTCGAGTTGTGGCAAGCAGTCTGTTTACTCTCGGCTGTTTAGCCGTG
TGGGGCATTTGGCAGTGGCGTAAGCTGCAAGCTTTCAAATCGGAACAAAAGCGCGAAGAGCAACTGCGCC
AAGATCCGATCAAGGTGTATGAGCTGCGCCAAGAGGTTGAACTGAATCAGGTGATGCTCAACATGAAGCA
GAGCCTAAATAAACACAACTACTTGTATGCACTGCCTTGGTACTTGGTTCTGGGTTTAGAAAATGCGGGT
AAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCTTCGGTCATGCGAGCTTCGGGACAAA
AAAGCGAAAACCCATACTCGTTTGATTGGTGGATTGGTGATGAATCTGTCCTGATTGATCCTGATGGTGA
GCTGTTAACGCAAGGCAATCGTAGTGAAGAGAATGATGGTGCGTTAGAGCGCCGCTTATGGTTGCATTTT
GTCGATTGGCTCGACCGCACTCGTAGCCGCCGCCCGCTAAACGGCATCGTGTTGGCGTTGGATGTGGCGC
ATCTTGCTACCGCCACAGCTTCAGAGCGTAAAGCTTATGCCAATTTGCTGCGTGCTCGTCTGCGTGAGTT
GATGGAAACCTTATCGACTCGTCTGCCGGTGTACATTGCACTGACCAAGCTCGACTTACTGCACGGTTTT
GAGCCTTTCTTTAAGCACTACACCAAAAGTCAGCGCGAAGAGGTGTTGGGTTTTACCTTCTCAATGGATT
CGGTAGATAACCTAGATTCATGGTTGGAAGAGTTTGCCAGCGAGTACACTCAATTTGTGTCACGAGTTAA
TGGCATGCTACCACATGCGGTCGCAGCGCCAATGACGCTTGAAGAACGTAACGCGATTTACAGCTTCACG
CGTCAAATCTCAGGTTTGAAAGAGATTTTGCAACAGTTTTTCCAAGAGGCTTTGGCGAGCGATCAATTCT
CAACGTCAGCGCTGGTGCGTGGTGCCTATTTCACGTCGGTTTACCAGCAAGGTGTACCCACCAACGCTTT
TGATGATGCGGCTTCCCGTCGTTATGGTCTGTCTCATGCGATTAATACGGCGCAGCGCGCGAAAAACTCC
ACGGTCTATTTCACGCAAAAACTGTTTACCCACATCATCTATCCTGAAGCGGGTTTAGCGTCGGATAATT
TCCGGGTTGCAAAAAACAAACGCCGTTTGATGGGGCTCTCTTTTGTCGCGTGCTCAGTGGCGACTTTGCT
GTTGGCAGGTACTTGGCATCGTAACTACCTCAATAACGTGCAACACGCCGATACTGTATTAACCAAAGTG
AATCAGTATAAAGAGCAGTTCCCGACCAGCCGTTCATTGGCCTCACAAAGAGAGGTATTGGATCCGTTGA
ACAAGATCCGTGAGGCGACACTGGAGTTTGGTTTCTTCCGTGATAAACCTCAGTACATCTCCGATTTTGG
TCTCTACCAAGGGCACACCATTGGCCCGAAAGTAGAAGAGACCTACTTAAACTTACTCGAAACTCGCTTC
TTGCCTCTGTTGATGGCGGACACCATTGTTGCGCTCAATCAAGCTGAGACAGATGAAGAAAAATTAGCGG
TGCTGCGCGTGTATCGCATGCTGGTCGATAAAAGTGGTCGTTACCAAGACTATGTGATGGATTATTTTGC
GAAGTATTGGCAAAAATCCTTCTCAGGTCAGCGTCAAATTCAGGAAGAGCTGCTCGGCCACTTAGATTAC
GCGATGCGTCATACGGACCTGACTGCAGAGCGTCTCAATGGTGATAAAGGGGCGGAGCAGGTGATGCGCC
CTTACGATAAAGTGATTGCTCGTGCTCAGGTTGAACTGGGTTCAATGCCAAACGACCAGCGCGTCTATCG
TAACTTGAAGTTGAGCGCACAAACGGTGCTTGGTCCTTCGGTTAACTTGCGTAGCTTGATTGGGCCGGTG
TTCGATGTGGTGTTTGAAGAGCGCGTACTTAACAGTAGCAGCCTGTTTATTCCTCAAATGCTCACCAAGC
GTGGTTTTGATGACTACTTTATGCCGCAATCTGAATCGGTCTCTGAGCTGGCACTGATTGACAGTTGGGT
TCTGGGACAGAGCAAAACGGCGCAGTTTAGTGAAGCAGACAAGCAGGCACTGCGCGAAAAAATCCGCGAT
CTTTATGTGGCGGATTACACCAACACGTGGCGCGCTGCACTCAATGAAATTGATGTGAAATATTTCAATG
ACATCAATGATGCGGTCATGGTTTTGGAAAATATCACCAGCAACCTTGAGCCGATGCAGCGTCTACTGCG
CACATTAGATGACAACACCCAACTGTACAGTGCGTTACCTAAAGATGAATCGGCGTTAAAAGAGCTGCTG
AAAAGCCCGAAATACAAAGTGGCTTCGATGATTGAAACTCCATTTGCCGATCTGAACGGTATGCTCAAAC
CAGTTGGCAGTAAACCAGCGTACATGACGGAAGTCTTGGCTTCGGTGGATGAGCTGAAAAGCTACTTGAA
ATCGATTCAAGATGCTCCCGATGTCGGTATGGCGGCGCTCGATGCGACCAAAGCGCGGGTCAAGCTGGTT
AATGCTGACCCTATCTATACCTTAAAACGTATTTCGTCAGGACTGCCGAAGCCGCTGGATAGCATGATGG
CAAAGCTTGCAGATGAGAGCTGGTATGTGGTCAAGCAAGAAGCGATCAAGCATCTTGAAGTACGCTGGAC
GGAGGATGTGTATAAAACCTTCCAAAGCAAGCTGGCTGGGCGTTATCCATTCAACCCCGCATCAAATAAA
GATGTGGCCTTGGCCGATTTTGAAGCCTTCTTTGCGCCGAATGGCACGTTAGACAATTTCTACAATCAGC
AACTGAAGATGTTTATTGATGAGAACATCAGCGTCGCGTCGGATGACTCAGCGCAGTCGATCATTCGTAA
AGAAGTGCTGGATCAGATCAAGCAAGCGCAGAAAATTCGTGAGGCTTTCTTCAACCGTAAAGGGATTTTG
GATGTCAGCTTCTCGGTTGAGCCGCTCAGTTTGAGTAACAACAAGCGTCGTAGTGTGCTGAATGTGGATG
GTCAGTTCTTAGCTTACAGCCATGGACCGCGTGAAAATGTGGAGCTGATTTGGCCTAACACGCTGCGTGA
TTCTGTGGTGTCTAAGGTGACCTTGATTCCAACCCAAACCAATATGTCACCGCGCAGTTTGCAAATCCAA
GGACCGTGGGCATTCTTCCGCTTATTGGATCAAGGTGATGTGGTTTCGGCGAGTCAAACGTCGGTTGATT
TCAAATTTATCGTCGATGGCGGTGAGATGATCTACCGCATTAACGCAGAGGCCGATGCCAACCCATTTAC
CGAACGCCTGTTCAAGTCGTTCAAACTGTCTAAAACACTCTATTAA
 Primer design