SecReT6
Protein ID: 488604310
SecReT6 ID758
T6SS typei4b
Gene symbol-
Locus tagBTI_501
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]538651..542553 [-]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDN0AK09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.90E-72, Aligned region: 189..449
IcmF-related [PF06761], Evalue: 1.00E-52, Aligned region: 494..861
DUF1215 [PF06744], Evalue: 1.10E-28, Aligned region: 993..1108
Protein Sequence: 1300 a.a.     [Download]
>gi|488604310|ref|YP_007917020.1| intracellular multiplication and macrophage-killing family protein [Burkholderia thailandensis MSMB121]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALAAALALWLATKLWRRWRVRRANRQLG
DILEQQAETGKVSAAVAEPAKRADLDVLRTRLADTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRHRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSISRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIANRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRMRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSTNPAAPGAAPSSAAAQGQQQGGLYNDASPTNVEDAYNALKTYLM
LSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIKSAERMITFYLSRVSDNDWPMIEANLALVDQTR
ENLRHVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTREAWFQYVQPAIRD
AATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKRWFTRQPGGQIAANVDINGNPADVPM
GPIGQEFVGLGRIVATRDGTSMLKGYMDTLSKARTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLK
FVDEQMLTGLTDSQRKALRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKVE
AGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLSARTWGDMGLVLTPDFTSGFARWVAPLAGGAATSA
GASSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWMNFVWPNPQGSPGATLSATTFDGRTVQLV
NEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGNVSVSVTMRIISTSQPTGGGGDQPQQQSLRGLRLPSSV
ADASAGGAANATAQPGSGAAAAAPQAAVATASASNAQGAQ
 
Nucleotide Sequence: 3903 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c542553-538651 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGATGCGCTACAGATCGGCCTCGTATGGGCGGCCGTCGCGCTCGCCGCCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTGGCGCGTGCGCCGCGCGAACCGCCAGCTCGGC
GACATCCTCGAGCAGCAGGCCGAAACCGGCAAGGTATCCGCCGCCGTGGCCGAGCCCGCGAAGCGGGCGG
ACCTCGACGTGCTGCGCACCCGCCTCGCCGACACGGTGAAGACGATCAAGACTTCGAAGATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGCTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACGGAAGGCATCCTGCTCGACACCGCGGGCCGCTATTC
GGTGCACGAGGAAGATCGCAGCGAATGGCTCGGCTTCCTCGATCTGCTCAAGCGCCATCGCCCGAAGGCG
CCGATCAACGGGATCATCGTGACGGCGAGCATCGCCGAGCTGACGGGCAACCGCCCCGAATTCGCGATCA
ATCTCGCGAAGAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAAGCCGATCTGATCACGGGCTTCACCGAATTCTTCAGCAGCAACGATCGCCAGGAA
TACGACCGCGTGTGGGGCGCGACGCTGCCGTACGAGCCGGACGAGAAGCGCGACGTCGTCGCGCTGTTCG
ATCAGCGCTTCGAAGAACTGTACGACGGGCTCAAGGAAATCAGCGTCGCGCAACTGTCGATCAGCCGCGG
CAACAAGCTTTCGCCCGGCCAACTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAGCCGATCTTCCGAGGTTTCTACTTCACGA
GCGCGCTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGAATCGCTTCGGCCTCGATTC
GCAAAGCCTGCCGAAACCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCGAAG
GTGATCTTCGCGGACCGCCAGACGGTGCGCCAGTTCGCGAGCCCGACGAAGACGCGCATGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGACGATCGGCAACCA
GCAGCTCGTCTCGAACGTGCAGGCCGACCTCGACAACGTGACCCGTCTGCAGCAGAACCGCAACGACCTG
CAGTCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGGATCGAGCAGCTCGAGCAGTTCCGCCGCGACA
AGCCGCTGTCCGTGTCGCTCGGCCTGTATCAGGGCAATCGGCTCGAGCAGCATCTGTTGACCGAATACTA
CAACGGCGTGCGGCAGATCCTGCTCGCCCCCGTGTCGGACAATCTCGCGTCGTTCCTGAAGGACGTGAAC
GCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGACGCCGGCGGGCCCGATGC
CGGTGTCGACGAATCCCGCGGCGCCGGGCGCGGCCCCTTCCTCCGCCGCCGCGCAGGGCCAGCAGCAGGG
CGGCCTCTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTGATG
CTGTCCGACAAGCGGCACGTCGAACAGGCGCACCTGACCGACCAGGTCGCGCGCTTCTGGCGCGGCTGGC
TCGAGACGAATCGCGGCAACATGCCGCGCGACGAGATGATCAAGAGCGCGGAGCGGATGATCACGTTCTA
CCTGTCGCGCGTGTCCGACAACGACTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGACCAGACCCGC
GAGAACCTGCGCCACGTCGTGCGCGGAATGCCGGCCCGCCAGCGCGTGTATGAAGAGATCAAGGCGCGCG
CGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACGGGCCTCGTCGCGGG
CAGCTACGCGATCCCCGGCACGTTCACGCGCGAGGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGCGAC
GCCGCGACGAAGGAGCTGCAGGCGAAGGACTGGGTGCTGAACACCGCATCGGCCGACGACCTGACGCTCG
AGGGCAGCCCCGAGCAGATCCAGAAGACGCTCGTCGCGATGTACAAGACCGAATACGCGCAGCACTGGCA
GAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAACTTCACGCAGGCGGTCGACGCGATGAACAAG
CTCGGCGACCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACGTCGTGGGACA
ACCCGTCGCTCGCGAACGCGACGATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCGGTGGTT
CACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCGATG
GGCCCGATCGGCCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCGACGCGCGACGGCACGTCGATGCTCA
AGGGCTACATGGACACGCTGTCGAAGGCCCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGG
CCCCGGCGCGCGTCAGTTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAG
TTCGTCGACGAGCAGATGCTGACGGGCCTGACCGATTCGCAACGCAAGGCGCTGCGTCCGCTCCTCGTGC
GGCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTGTGGAACGC
GCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTTGCGGCGGGCGCGAAGGTGGAA
GCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCACGACGC
TCGGGCCGCTCGCGGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGAGACATGGGCCTCGTGCT
CACGCCGGACTTCACGAGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGCGCC
GGCGCGTCGTCCGAGCCGCAGACCGTGTTCCAGGTGTTGCCGCAGCCGAGCAGCGGCACGACCGAGTACA
CGATCGCGATCGACGGCCAGCAACTGCGCTACCGCAACACGCCGCCGCAATGGATGAACTTCGTGTGGCC
GAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCGACGACATTCGACGGCCGCACGGTGCAGCTCGTC
AACGAGCCGGGCCGCTACGGCCTCGAGAAACTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCA
CGTTCGATCTGACGTGGACGCAAGGCAACGTCAGCGTGTCGGTGACGATGCGCATCATCAGCACGTCGCA
ACCGACGGGCGGCGGCGGCGATCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCGCCTGCCGTCGTCGGTC
GCCGACGCGAGCGCGGGCGGCGCGGCCAATGCAACGGCGCAGCCCGGCTCGGGCGCCGCGGCCGCGGCCC
CGCAGGCCGCCGTCGCGACGGCTTCCGCATCGAACGCACAGGGGGCGCAATGA
 Primer design