SecReT6
Protein ID: 488605363
SecReT6 ID760
T6SS typei3
Gene symbol-
Locus tagBTI_4633
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1304085..1308146 [+]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDN0AG25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-98, Aligned region: 612..932
ImcF-related_N [PF14331], Evalue: 4.30E-93, Aligned region: 293..565
DUF1215 [PF06744], Evalue: 1.00E-35, Aligned region: 929..957
DUF1215 [PF06744], Evalue: 1.00E-35, Aligned region: 1041..1165
Protein Sequence: 1353 a.a.     [Download]
>gi|488605363|ref|YP_007921082.1| intracellular multiplication and macrophage-killing family protein [Burkholderia thailandensis MSMB121]
MNKFLSFLVSRPFLAFVALLVVALVIWFAGPFVAFGGLTPFAGAGMRVLAIALLLAGVLLWLAGWPTGVV
FVALLCVLIWHASPLLAFGRATPFAPESVRAIAIAVVLAAFVLHLAFRLLRKMRTDPDFLKNLLEFGSKQ
HESPAAGRLIAVNAAIAGAIARLKGMRTGARGLDRLLRGKRYLYELPWYVTLGSQASGKTSALINAGLSF
PVAAQMQRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSTQAVPQSPTAAMATAAAASAAAATAPN
LAFVDERQAQWRQTVDQAEWLGFLRMLRKHRPREPINGALLAVDVAALTSADENARHAEAAALRARLAEL
RAELGVRFPVYLLVTKMDRLPGFAEYFSSLTTEGRAQTWGFTLPYGKETIADEGIHARCADELGELAARL
AAGVNTRLQEEHDTQRRRRLAALAEEFLVLTRPLGELIDRVFVDSRYDDTQHHATLRGVYFTSAAQTGGE
IVAETRTVAQRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDARLVQPNLRWEYRSRTLGLAGH
ALALLLFAWAAIGLRVSMGNNGDYLDAVARKTTALASQVGQLYRTPKPEAVPDVLTQARALPAYPGLDLS
APDGGWRFGLYTPPGIVAESQRTYSALEDNLLLPQIVRRIEAVLSQAIADRDPKAAYDALRVYLMLYDKA
RFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVGQLFSGERVVQSPLIRNDALIRQARAFLDGSNATER
LYERAKAAMEKEAPDEFTLIRAVGPQAGTVFTRASGAPLARGVPGLFTFDGYRRVFDKRLAEFVQAARED
DAWVMGRAYLGGAQKKTAEIANAIALADDPLTEAIRRQYLMEYAQQWDAFLGDIRTIGGTSLAFDLVVLR
SFAAPDSPLDRLARAAVRETTLAQPVASADRSFLQKASDQLSQKADKVLGVRAEERVERELVDNRFAGLR
EMVTGRADTQTDTPPPAAPAGKSGLEAVANLLNDYYTALTVADDALTNNSMPPANDTAAKLKMAAQTMPA
PFRAVLTELAAQGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAADSRRDVGIEDFTRVFAQGGVI
DDFFAKTLAPFVDTSTRPWRYKTLPGATEPVQGPDLEPFQHAKAIREVFFGAPGQKQMAWKADIRIPELD
PTITGLAIDIDGQTTLYQHGPVAPFTVSWPGPRGGVHAELTASPRIRPDTSTVSTDGPWALLRLLQKGRV
AETATPGRTRVTLDFDGRKAVLDIASTGSVANPLTSDVLKTFRCPGAMPMFNLADTGAPPGLPPASPPAP
PAADAAHHGQQARATQAVRSRAL
 
Nucleotide Sequence: 4062 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1304085-1308146 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACAAGTTCCTGTCCTTTCTGGTGTCGCGACCGTTCCTCGCGTTCGTCGCGCTGCTCGTCGTCGCGC
TCGTCATCTGGTTCGCCGGTCCGTTCGTCGCGTTCGGCGGGCTCACGCCGTTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCTGGCCGACGGGCGTGGTG
TTCGTCGCGCTGCTCTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCCGTGCGACGCCGT
TCGCGCCGGAATCGGTCCGGGCGATCGCGATCGCGGTCGTGCTCGCGGCGTTCGTGCTGCATCTCGCGTT
CCGGCTGCTGCGGAAGATGCGCACGGACCCGGACTTTCTGAAGAACCTGCTCGAGTTCGGCAGCAAGCAG
CACGAATCGCCCGCGGCCGGCCGGCTAATCGCGGTCAACGCGGCGATCGCCGGCGCGATCGCGCGCCTGA
AGGGCATGCGCACCGGCGCGCGGGGGCTCGACCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCAGGCGTCGGGCAAGACGAGCGCGCTCATCAACGCCGGGCTGTCGTTT
CCGGTCGCGGCGCAGATGCAGCGGGCGGCGGCCGGGCTGCCGGATCACGGCGGCTCCGTCGACTGGTGGC
TGACCAACGATGCGGTGCTGATCGACACGGCCGGGCATTACACGCGTCACGGCACGTCGACGCAGGCCGT
GCCGCAATCGCCCACCGCCGCGATGGCGACGGCGGCGGCCGCGTCGGCGGCCGCGGCGACGGCGCCGAAC
CTCGCGTTCGTCGACGAACGGCAAGCGCAATGGCGGCAGACCGTCGATCAGGCCGAATGGCTCGGCTTTC
TTCGGATGCTGCGCAAGCACCGCCCCCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCGC
GCTGACGAGCGCCGACGAAAACGCGCGCCATGCCGAAGCCGCCGCGCTGCGCGCGCGGCTCGCCGAACTG
CGCGCGGAGCTGGGCGTGCGCTTTCCCGTCTATCTGCTCGTCACGAAGATGGACCGGCTGCCGGGCTTCG
CCGAGTACTTCAGCTCGCTGACCACCGAGGGCCGCGCGCAGACGTGGGGCTTCACGCTGCCATACGGCAA
GGAGACCATCGCCGACGAAGGCATCCATGCGCGCTGCGCCGACGAGCTGGGCGAGCTGGCCGCGCGGCTC
GCGGCGGGCGTCAACACGCGCCTGCAGGAAGAGCACGACACGCAAAGACGCCGCCGGCTCGCCGCGTTGG
CGGAGGAATTTCTCGTGCTGACGCGCCCGCTCGGCGAACTGATCGATCGCGTCTTCGTCGATTCCCGCTA
CGACGACACGCAGCACCACGCGACGCTGCGCGGCGTGTACTTCACGAGCGCCGCGCAGACGGGCGGCGAA
ATCGTCGCCGAAACGCGCACCGTCGCGCAGCGCCTTGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCG
CGCGCGCGGCGCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCC
GGACGCGCGTCTCGTCCAGCCGAATCTCCGGTGGGAGTACCGCTCGCGCACGCTCGGCCTCGCCGGTCAC
GCGCTCGCGCTGCTGCTGTTCGCGTGGGCCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGGCGATT
ATCTCGACGCGGTCGCGCGCAAGACGACGGCGCTCGCGTCCCAGGTCGGCCAGTTATACAGGACGCCGAA
GCCCGAGGCCGTGCCCGACGTGCTGACGCAAGCGCGCGCTCTGCCCGCGTACCCGGGGCTCGACCTGTCC
GCGCCGGACGGCGGCTGGCGGTTCGGCTTGTACACGCCGCCCGGCATCGTCGCCGAAAGCCAGCGCACAT
ACAGCGCGCTCGAGGACAACCTGCTGCTGCCGCAGATCGTGAGACGCATCGAGGCGGTGCTGTCGCAGGC
GATCGCCGATCGCGATCCGAAGGCCGCGTATGACGCGCTGCGCGTCTACCTGATGCTGTACGACAAGGCC
CGCTTCGACGCCGCGCAGGTCGAGGCGTGGGTTCTCGACGACTGGGCGCGGACCGACAGCGCCGCGGTCT
TCGGCGGCCGCGCGTCGATGATCGCGCACGTCGGGCAGTTGTTCTCCGGCGAGCGCGTCGTGCAATCCCC
GCTGATCCGCAACGACGCGCTGATCCGGCAGGCGCGCGCGTTTCTGGACGGCAGCAACGCGACCGAGCGG
CTCTACGAGCGCGCGAAGGCGGCGATGGAGAAAGAAGCGCCCGACGAGTTCACGCTGATCCGGGCCGTCG
GCCCGCAGGCCGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGCGGCGTGCCCGGCCTCTT
CACGTTCGACGGCTACCGGCGCGTGTTCGACAAGCGTCTCGCCGAATTCGTGCAGGCCGCGCGCGAAGAC
GACGCATGGGTGATGGGCCGCGCCTATCTCGGCGGCGCTCAAAAAAAAACGGCTGAGATCGCGAATGCGA
TCGCGCTCGCCGACGATCCGCTGACCGAAGCGATCCGCCGGCAATACCTGATGGAATACGCGCAGCAATG
GGACGCGTTTCTCGGCGACATCCGGACGATCGGCGGCACGAGCCTCGCGTTCGACCTCGTGGTGCTGCGC
AGCTTCGCGGCGCCGGATTCGCCGCTCGATCGGCTCGCGCGCGCGGCGGTTCGCGAGACGACGCTCGCGC
AGCCCGTCGCGAGCGCCGACCGCTCGTTCCTGCAAAAGGCGTCCGACCAGTTGAGCCAGAAAGCGGACAA
GGTGCTCGGCGTGCGCGCGGAGGAACGCGTCGAGCGCGAGCTCGTCGACAACCGCTTCGCGGGCCTGCGC
GAAATGGTGACGGGCCGTGCGGACACGCAGACGGACACGCCGCCGCCGGCCGCGCCGGCGGGCAAGAGCG
GGCTCGAGGCGGTCGCGAACCTGCTGAACGACTATTACACGGCGCTGACCGTCGCGGACGACGCGCTGAC
GAACAACAGCATGCCGCCCGCGAACGACACCGCGGCGAAGCTGAAGATGGCGGCGCAGACGATGCCCGCG
CCGTTTCGCGCGGTGCTGACCGAGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCGGCCAGT
TGCTGTCGCGACAGTTGCAGGCGACGGTGGGCGACGTGTGCCGCCTCGCGATCGAGGGCAACTATCCGTT
CGCGGCCGACAGCAGGCGCGACGTCGGCATCGAGGATTTCACGCGCGTGTTCGCGCAGGGCGGCGTGATC
GACGACTTCTTCGCGAAGACGCTCGCGCCGTTCGTCGACACATCGACGCGGCCATGGCGCTACAAGACGC
TGCCCGGCGCGACCGAGCCGGTGCAGGGCCCCGATCTCGAACCGTTCCAGCACGCGAAGGCGATCCGCGA
AGTGTTTTTCGGCGCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAGCTGGAC
CCGACGATCACGGGCCTCGCGATCGACATCGACGGACAGACGACGCTCTATCAGCACGGCCCCGTCGCAC
CGTTCACGGTGAGCTGGCCGGGGCCGCGCGGCGGCGTTCACGCGGAGCTCACCGCGAGCCCGCGGATTCG
GCCCGACACGTCGACGGTGTCGACGGACGGCCCGTGGGCGCTGCTGCGCCTGTTGCAGAAGGGGCGCGTG
GCCGAAACGGCGACGCCCGGCCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGCTCGACA
TCGCGAGCACCGGCAGCGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCCGGGCGC
GATGCCGATGTTCAATCTCGCGGACACCGGCGCGCCGCCCGGACTGCCGCCGGCGAGCCCGCCCGCGCCG
CCCGCCGCGGACGCCGCGCATCATGGGCAACAGGCGCGGGCGACACAGGCGGTTCGCTCGCGCGCGCTGT
GA
 Primer design