SecReT6
Protein ID: 488605431
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5346
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2168073..2169584 [+]
Producthypothetical protein
NoteTssC
UniProt IDN0AN18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|488605431|ref|YP_007921786.1| hypothetical protein BTI_5346 [Burkholderia thailandensis MSMB121]
MSMQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIE
QLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVW
DQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWS
ELSNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFC
WANSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSES
GLMPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSA
EDTQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRL
VSKLPSTKQEVTT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2168073-2169584 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAGTATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATC
TGAAGGACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAAGCCGCCGAGGCGGTGCAGAACGCCGT
CGAAACGCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGCGAGGATGTCGCGCAGACGATCGAG
CAACTGGTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACTCTCGTGCTGCACAACAAGCGCTTTC
AGAGTCTCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGACACGAGCGAGAACCTGAA
GATCCGCTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGG
GACCAGAGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGATCGGCGATTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGAT
CTCGGCGGCCGCGCACGCGCCGTTCATCGCGGCCGCCGCGCCCGGCCTCCTGCAGATGGACGACTGGAGC
GAGCTGTCGAATCCGCGCGACGTGTCGAAGATCTTCACCGCGACCGAATACGCATTCTGGCGGCGCCTGC
GCGAGAGCAACGACTCGCGCTATCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGCGTGCCGTATGGCCC
GAAGACGCAGCCCGTCGAAGAGTTCGGTTTCGAGGAGAAGGTCGATCCGAACCGCGCCGAGGACTTTTGC
TGGGCGAACTCCGCTTATGCGATGGGCGCGAACATCACGCGCGCATTCAAGACCTACGGCTGGTGCACGA
AGATTCGCGGCGTCGAGTCGGGCGGCGCGGTGGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCG
CGAAGTCGATCTGCACTGCCCGACGGAAATCGCGATCTCGGACCGCCGCGAGCACGAGCTGTCGGAGTCC
GGCCTGATGCCGCTCGTGTACCGGAAGAATTCGGACACCGCCGCGTTCATCGGCGCGAAGACCGTGCACC
GTCCGGCGATCTACGAGGACGACGATGCGACCGCGAACTCGAATCTGTCGTCGCGGCTGCCGTACATCTT
CGCGACGTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAGTCGGCC
GAGGACACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATATCGAGCG
AGGTGACGAAATCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGATGAGATTCCGGAGAACCCCGG
CTACTATCGCGCGCAGTTTTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTG
GTTTCGAAGCTTCCGTCGACCAAGCAAGAGGTGACGACCTGA
 Primer design