SecReT6
Protein ID: 488605448
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4911
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1633838..1635151 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDN0AG94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-75, Aligned region: 48..252
OmpA [PF00691], Evalue: 5.10E-14, Aligned region: 249..258
OmpA [PF00691], Evalue: 5.10E-14, Aligned region: 317..415
Protein Sequence: 437 a.a.     [Download]
>gi|488605448|ref|YP_007921358.1| type VI secretion system OmpA/MotB family protein [Burkholderia thailandensis MSMB121]
MNSSSDSFSAGAGGFVPPNPGGAHPAAAPAGAAASQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVHH
PNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNETW
GGEKFFHLLDRLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPAL
SPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAQPAPHP
APAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNQVPGSVRVS
GYTDDTPVHSARFASNWDLSRERAEAVRGLIAARLDRPDRIAAEGRGTLDPVAPNDSPANRARNRRVEIT
LMLAPGGDAAHTTKETP
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1633838-1635151 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACTCTTCTTCCGATTCGTTCTCGGCCGGCGCGGGCGGATTCGTGCCGCCGAACCCGGGCGGCGCGC
ATCCGGCCGCCGCGCCGGCGGGCGCGGCCGCGTCGCAGCCGAGGCCGGGCCGGTGGGCGGCGAGCGGCAC
GAATCCGCTCGTCGCGGCCGCGAACCCGCTGCTGAACCTCGTGCCGCAGATCCGCTCGACGGTCCATCAT
CCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGCAGG
CGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTAGACGAGGCTGCCGC
GCTGACGCCGTGGGGCGGCAGCGTGTGGTCGTCGCACAGTCTGCTCGTGTCGTTCCACAACGAGACGTGG
GGCGGCGAGAAGTTCTTCCATCTGCTCGATCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGCTCG
AGCTGCTCTATTTCTGCCTCGCGCTCGGCTTCGAAGGGCGCTATCGCGTGCTCGACAACGGCCGCGCGCA
GCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCGCTC
TCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGTGCG
TCGCGCTCGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTCGGA
CCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCAGCCCGCGCCGCATCCG
GCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCGACG
AAGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGGTCCGGCTCGACGTCGGTGATCGA
TCGCTACATGCCGGTGCTCACGCGCGTCGCCGACGCGCTGAACCAGGTGCCGGGCAGCGTGCGCGTGAGC
GGCTACACCGACGATACGCCGGTGCACAGCGCACGCTTCGCATCGAACTGGGACTTGTCGCGCGAGCGCG
CGGAGGCGGTCCGCGGCCTGATCGCCGCGCGGCTCGACCGCCCGGACCGGATCGCGGCCGAAGGGCGCGG
CACGCTCGATCCGGTCGCGCCGAACGATTCGCCGGCGAACCGCGCGCGCAACCGGCGCGTCGAGATCACG
CTGATGCTCGCGCCCGGCGGCGACGCCGCGCACACGACGAAGGAGACGCCCTGA
 Primer design