SecReT6
Protein ID: 488605500
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5345
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2167525..2168076 [+]
Producthypothetical protein
NoteTssB
UniProt IDN0APD9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-55, Aligned region: 11..160
Protein Sequence: 183 a.a.     [Download]
>gi|488605500|ref|YP_007921785.1| hypothetical protein BTI_5345 [Burkholderia thailandensis MSMB121]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFSSMESFEPAAVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAPGQSGSAGEGGDHQPEEGAK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2167525-2168076 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTCGAGGTGTACGGATCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGTCCCGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GACGAGCGGATGGCGCAGATCGCACCGTCGCTCAGCTATCACGTGAAGAACGTGCTCACCAACGACGGCA
CGCTGATTCCGATCGATCTCACGTTCTCGTCGATGGAATCGTTCGAGCCCGCGGCGGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCCCGCAACCGCCTGAAGGAGTTGCTGACCTACATGGACGGCAAG
GCGGCGGCGGAAGACGTGATCCAGGAATTGCTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGC
CGGGGCAATCCGGCAGCGCCGGTGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA
 Primer design