SecReT6
Protein ID: 488605513
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5344
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2166550..2167491 [+]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDN0AGF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-18, Aligned region: 46..104
Protein Sequence: 313 a.a.     [Download]
>gi|488605513|ref|YP_007921784.1| impA-related N-terminal family protein [Burkholderia thailandensis MSMB121]
MNDDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASVETACLALLKKAKDVRVAIWH
LRACIARRGLSGLADGVRLLADLMSAPVEALHPRALPDESPGETLLIHLGWLAGPQFLHQLGGSRFEDRD
ATLNDLIGGRAAAIVEDRGYRDRANTLVHDIQDSLSRIRKSIAVVEQELNLSRALDLLSVAASRLAQTGS
GSEANASVADEKLADAAPGSPAPGAQQPAVGPGCVLRSRQEVGAALERIVEYFRLHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLNRPQSSIK
 
Nucleotide Sequence: 942 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2166550-2167491 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACGACGATGCACTGCCGGGTCATTCGCCGGATTTGCTGGATTTCGACGAGGATTTTATCAAAATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTATGCGCCGCAACGCAAGGGCGAGAGTGCGTTCCAGTG
GGCGTCCGTCGAAACGGCTTGTCTCGCGCTATTGAAAAAGGCGAAGGACGTTCGGGTCGCCATCTGGCAT
CTGCGCGCATGTATCGCGCGGCGCGGATTGAGCGGGTTGGCCGACGGCGTTCGATTGCTGGCCGATCTGA
TGAGCGCGCCCGTCGAGGCATTGCATCCTCGCGCGCTGCCTGACGAATCGCCGGGCGAGACGCTCCTGAT
TCATCTCGGCTGGCTTGCGGGGCCGCAGTTTCTGCATCAGCTCGGCGGTTCCCGGTTCGAAGACCGCGAT
GCGACGCTCAACGACCTGATCGGCGGGCGGGCCGCCGCGATCGTGGAGGATCGCGGCTATCGCGATAGAG
CGAATACTCTTGTACATGACATTCAGGATTCCTTATCGCGAATCAGGAAATCGATTGCAGTGGTGGAGCA
GGAGCTCAACCTCTCTCGCGCGCTCGACCTGTTGAGCGTCGCGGCGTCGCGGCTCGCGCAAACGGGATCG
GGGAGCGAGGCAAACGCAAGCGTCGCCGATGAGAAACTGGCCGATGCAGCGCCCGGCTCGCCGGCGCCCG
GCGCGCAGCAGCCCGCCGTGGGGCCGGGCTGCGTGCTGAGGTCGAGGCAGGAAGTCGGCGCGGCGCTCGA
GCGGATCGTCGAGTACTTCCGCTTGCACGAGCCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAACCGGCCGCAGAGCTCCATCAAGTAA
 Primer design