SecReT6
Protein ID: 488605558
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4919
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1645854..1646372 [+]
Productlysozyme family protein
NoteTssE
UniProt IDN0AGJ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-22, Aligned region: 36..150
Protein Sequence: 172 a.a.     [Download]
>gi|488605558|ref|YP_007921366.1| lysozyme family protein [Burkholderia thailandensis MSMB121]
MRAARDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLTWLLNTRNGEDGFVDWPAFAHAQA
SVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDTPGGAAGERRHNVLMFEIKG
TLWSVPHPVEFVLRSDLDLETGAMALQPAAGG
 
Nucleotide Sequence: 519 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1645854-1646372 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCGCGCCGCGCGCGACCGGCTGCAGCCGGCGCTGCTCGACCGGCTGACCGACGCTGAGCGCGAGCGGC
GCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCGGCTGCGCGCGGCGGTGCTGCGCGACCTGAC
GTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTCGACTGGCCGGCGTTCGCGCATGCGCAGGCG
TCGGTGCTCAACTACGGGATGCGGCCGCTAGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTGG
AGGCGTCGATCCGCGATGCGATCGTGCGCTTCGAGCCGCGCATCGCGCCGGACAGCGTCGAGGTGCGCAG
CGTGCTCGACACGCCGGGCGGCGCGGCGGGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGC
ACGCTGTGGTCGGTCCCGCATCCGGTCGAGTTCGTGCTGCGCTCGGATCTCGATCTGGAGACGGGCGCGA
TGGCGCTGCAACCGGCGGCGGGAGGCTGA
 Primer design