SecReT6
Protein ID: 488605568
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3994
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]470687..471463 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDN0AGK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.40E-24, Aligned region: 35..195
Protein Sequence: 258 a.a.     [Download]
>gi|488605568|ref|YP_007920455.1| type VI secretion lipofamily protein [Burkholderia thailandensis MSMB121]
MNERHISMPSAAHARRPVRPPRPRPACAAALVALAALTGCATGVTEEQARADVRWDYAPDALRIDIDASP
RLNEYLNAPHTLLLAVFQSADAQTFRELADDPDRLRAMLAAGGPAADFIQTTRYVVVPGARVALSIDRAQ
RARYVGIVAGYYDADGPRAARLFDVPLHIDKRGWFSSTYRAAPRTLGLRLRLGAQSITDAREAQLNLPPP
GARAWTTLDSGAKTLTLPSADANANANGGGNRDSNENGEAAARAPLKR
 
Nucleotide Sequence: 777 bp     [Download]
>gi|488605303|ref|NC_021174.1|:470687-471463 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACGAACGACACATTTCGATGCCGTCGGCGGCACATGCGCGCCGGCCGGTTCGGCCGCCGCGGCCAC
GCCCCGCATGCGCCGCCGCGCTCGTTGCGCTCGCCGCACTCACCGGCTGCGCGACGGGCGTCACCGAAGA
GCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCCGATGCGCTGCGCATCGACATCGACGCATCGCCG
CGGCTGAACGAATACCTGAACGCGCCGCACACGCTGCTGCTCGCGGTGTTCCAAAGCGCGGACGCGCAGA
CGTTCCGCGAGCTCGCCGACGATCCGGACCGGCTGCGCGCGATGCTCGCGGCGGGCGGGCCCGCGGCGGA
CTTCATCCAGACGACGCGCTACGTTGTCGTGCCGGGCGCGCGCGTCGCGCTGTCGATCGATCGCGCGCAG
CGGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACGACGCCGACGGCCCCCGCGCGGCGCGCCTCTTCG
ACGTGCCGCTGCACATCGACAAGCGCGGCTGGTTCTCGTCCACCTATCGCGCTGCGCCGCGAACGCTCGG
GCTGCGGCTCAGGCTCGGCGCGCAGAGCATCACCGACGCGCGCGAAGCGCAGTTGAACCTGCCGCCGCCC
GGCGCGCGCGCATGGACGACGCTCGACAGCGGCGCGAAAACGCTGACGCTGCCGAGCGCTGACGCAAACG
CAAACGCAAACGGCGGCGGCAACCGCGACAGCAACGAAAACGGCGAGGCCGCCGCCCGCGCGCCGCTCAA
GCGATGA
 Primer design