SecReT6
Protein ID: 488605583
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4917
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1643733..1645241 [+]
Producthypothetical protein
NoteTssC
UniProt IDN0AGL4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|488605583|ref|YP_007921364.1| hypothetical protein BTI_4917 [Burkholderia thailandensis MSMB121]
MNEHAPTRADTREAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHEEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFYFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTEAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVEGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAASA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1643733-1645241 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAATGAACACGCTCCAACCCGGGCCGACACGCGCGAGGCCGCGCAGCCCGTCGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAGAAGGAGTTCAAGCCGAAGACCGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCACGAGGAGTTCC
AGACGCTCGAGGGCGCATGGCGCGGGCTGCACTATCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCGCTGCCCGCGTCGCGCAACGAGCTCGCGCGCACGCTGAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTCTTTCGCAAGGTCTACGAAGAGGAGTACGGGCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCTATTTCAACCACAGCCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCCGCGCACGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTGGCCAATCCGCGCGATCTGACGAAGATCTTCCAGAACACCGAATACGCGGCGTGGCGCAGCCTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTATGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAAGACACCGAAGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCATACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTCGAAGGGCTGCCGTGCCACACGTTCCCGACCGACGACGG
CGGCGTCGACCAGAAGTGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTTCATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTTGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCATCGAAGTTCTTCCTGCGGCCGCATTACCAGCTCGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGAGCGCATGA
 Primer design