SecReT6
Protein ID: 488605700
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4912
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1635154..1638783 [+]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDN0AQ03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.10E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 4.10E-96, Aligned region: 753..837
ImcF-related_N [PF14331], Evalue: 4.10E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.80E-94, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.80E-94, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 2.80E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 2.80E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|488605700|ref|YP_007921359.1| intracellular multiplication and macrophage-killing family protein [Burkholderia thailandensis MSMB121]
MSHAVARIVRPLPSREIWTFAGLVVLACFVWLAGPLFAFAELRPFESGWVRALTIVALFAAWGARIAWRN
WRAGQLNAQLLNQLREAAPRPAATGDPARAQLDELRSRFDEASTLLKKVRFGAADGARKGLPQWLERMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRSQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAGGFDLRAAFDREYRLLHKRLNDGLPELLA
SQTDARQREMSYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSAGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRVLQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDQVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPDAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALREAQPDEAEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRSHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLRPSTASY
DFSVARAVGPDASLAFRRQSGRSLADGVPGLYTRNGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDVRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARSSLAQIFAGQPGADAGAAAASPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGATPPPSDAPARLRAQAGRLPTPFREVLDDLSNVANGSVASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGASRDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPAAAAMLGAFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMVLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGAAGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1635154-1638783 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGAAATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGCTTCGTCTGGCTCGCCGGGCCGCTGTTCGCGTTCGCCGAGCTCCGCCCGTTCGAGAG
CGGCTGGGTGCGCGCGCTGACGATCGTCGCGCTGTTCGCCGCGTGGGGCGCGCGGATCGCCTGGCGCAAC
TGGCGCGCGGGCCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCTGCGA
CGGGCGACCCCGCGCGGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCGTCGACGCTCTTGAA
GAAGGTCCGCTTCGGCGCCGCCGACGGCGCGCGCAAGGGCCTGCCGCAATGGCTCGAACGGATGTCGCGC
CAGTATCTGTACCAGTTGCCGTGGTACGTGTTCATCGGCGCGCCCGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTGGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTATACGACGCAC
GAGAGCAATCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAATACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCTCGCAGCTCGGCATTCGCTTTCCG
GTGTACCTGCTCGTGACGAAGGCGGACCTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAGGCGGGCGGCTTCGATCTGCG
CGCGGCGTTCGATCGCGAATACCGGCTGCTGCACAAGCGCCTGAACGACGGGCTGCCGGAGCTGCTCGCG
TCGCAGACCGACGCGCGCCAGCGCGAGATGAGCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTTTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
GTACCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGGCCGGCCGCAGCTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTCCGCGAGGCGGCGCTCGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGCGT
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGTGTCGCGGTGCTGTTCGCGTGGCTGCGCAGC
TATTCGCGCAATCGCGACTATCTCGACCAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCGAAGTTCACGGGCGCGGCCGACATCGTCCAGTTGCTGCCCGTGCTCGACGAGCTGAGCGGGCTGCC
GGACGCGGGCGGCGTCGACTTGCGGCACCCGCCGCTCGCGTACCGCTGGGGCCTCTTTCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTGTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGAGGCGCAGCCCGACGAGGCCGAATATGCATACGCGGCGCTCAAGGCGTA
TCTGATGCTCTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCCGCCGATTTCTCGTCGGCGCAGCGCAGCGCGCTGCGCTCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTCCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTACCGGCAGCTCGCGCGCACGCTGCGCCCGAGTACCGCGTCGTAT
GACTTCAGCGTCGCGCGCGCGGTCGGGCCGGACGCGTCGCTCGCGTTCCGGCGGCAGAGCGGCAGGAGCC
TCGCCGACGGCGTGCCGGGCCTCTATACGCGCAACGGCTACCGCAACGTGTTCGCGCCGCGGCTGCCCGG
CGCGATCGATTCGTATGGGCGCGAGGAGGTGTGGGTGCTGAATCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCGTGGGCGCGCGACGTCCGGCAGCTCTATCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCGGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAACCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAGCTCGCTCGCGC
AGATCTTCGCGGGCCAGCCGGGCGCGGACGCGGGCGCGGCGGCCGCGTCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGCGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCAACCGACGACGCGCTGCGCAGCGGCG
CGACGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGCTGCCGACGCCGTTTCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCGTCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTATCCGTTCGCGCGCG
GCGCGTCGCGCGACGTCGCGCCGTCCGACTTCGCGCAACTGTTCGCGGCGGGTGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCACCCGTGGCGCTTCAACAACCGCAACGCC
GAAGCCGATCCGGCGGCGGCCGCGATGCTCGGCGCGTTCGAGAAGGCTGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
TGAGATGGTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACCGCGGTG
CAGTGGCCGGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAACAGTCGGGCGCGGCGGGCG
GCTTCACGACCGAGGGGCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGCGGGCGCGG
GCCCGAGCAGATGGTCGCGAGATTCGCGGTGGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design