SecReT6
Protein ID: 488605718
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3981
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]451911..453719 [-]
Producthis Kinase A domain protein
NoteVirA
UniProt IDN0AH25
KEGG IDbtd:BTI_3981
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 2.30E-20, Aligned region: 454..576
MASE1 [PF05231], Evalue: 9.70E-14, Aligned region: 46..323
HisKA [PF00512], Evalue: 2.50E-06, Aligned region: 314..338
HisKA [PF00512], Evalue: 2.50E-06, Aligned region: 337..402
Protein Sequence: 602 a.a.     [Download]
>gi|488605718|ref|YP_007920442.1| his Kinase A domain protein [Burkholderia thailandensis MSMB121]
MHENSIDAGPPARARPARIKQASRRAPRRGDRTFAPGGALNAAGLLLLLFYANHLLTRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWGLGVVSLFVTLLAAGSLDWVPWRVDALFAAVNAIEAIAGAWLARRYV
SPGGGVDTLRGFAMFVLLLPLGMAAMHATLAAVILSVWLNDREWLNEWSRAYAANALALLALLPALLTWN
ARACRAAWSRSRNQLPALATFGSLCFASIWGDQAEVARALLALSLCWAGIEGGLVLASQLNALAAIALIA
MTLGGRGPYALHYDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFN
NVLTTIDCHAEYASDRLADGARADESIDEIHRAVERGRDLTTQILLAARRGEPVLTRVSVDEVVDDALAA
MRAAALRGIEIVRCGDDACGDARRDDARHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGANDGGAPA
ADAFDVAIGEPSVPGGVWIEVSDDGDGIGVEPLDRIFEPFYSNRSGAPGTGLGLAIVAGAAIAHRGQIAV
ATDRGAGSRFRLTLPAAHGTGASGAPGEADAGARGAVQEKKR
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c453719-451911 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCACGAAAATTCCATCGATGCCGGCCCGCCCGCGCGCGCCCGGCCCGCACGCATCAAGCAGGCGTCGC
GCCGCGCGCCGCGCCGCGGCGATCGCACATTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGACGCGGCCGGGCGCATGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCCCCGGTACTGGGCATCGCGTTGCTGCTGCATTGCCGGCGGCCGCTCGCGTGGG
GGCTCGGCGTGGTTTCGCTGTTCGTCACGCTGCTCGCCGCGGGCTCGCTCGATTGGGTGCCGTGGCGCGT
CGACGCGCTGTTCGCGGCCGTCAACGCAATCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTACGTG
AGCCCGGGCGGCGGCGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGTTGCCGCTCGGCATGG
CGGCGATGCATGCGACGCTCGCGGCGGTGATCCTGTCTGTGTGGCTGAACGATCGCGAGTGGCTGAACGA
ATGGTCGCGTGCGTATGCGGCAAACGCGCTCGCATTGCTCGCGTTGCTTCCGGCGCTTCTCACGTGGAAC
GCGCGCGCTTGCCGCGCGGCGTGGTCGCGCAGCCGGAATCAGTTGCCCGCGCTCGCGACCTTCGGTTCGC
TGTGCTTCGCATCGATATGGGGCGACCAGGCCGAGGTCGCGCGCGCGTTGCTCGCGCTGTCGTTGTGCTG
GGCCGGGATCGAGGGCGGTCTCGTGCTCGCGTCCCAACTCAACGCACTCGCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGCCGCGGGCCGTATGCATTGCATTACGACGGTCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGACGCCGGCTCGCGCG
GCAGATCGAGCGATCGCGCAGGTTCGAGTCGCTCGGCTTCTTCGCGGGCGGGATCGTTCACGACTTCAAC
AACGTGCTGACGACGATCGATTGCCATGCCGAATATGCCTCGGATCGGCTGGCGGACGGTGCGCGCGCGG
ACGAGTCGATCGACGAAATTCATCGCGCGGTCGAGCGGGGGCGCGATCTGACGACGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAACCCGTGCTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGACGCGCTCGCCGCG
ATGCGCGCGGCCGCCCTGCGCGGCATCGAGATCGTCCGGTGCGGCGATGACGCGTGCGGCGACGCGCGGC
GTGACGACGCCCGTCACGTCGTATTCGCCGATCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAACGCAGTGCGCGCGGCGCGCGCGACGGTCGTCGTGCGTGTCGGTGCGAACGACGGCGGCGCGCCGGCC
GCCGATGCATTCGATGTCGCGATCGGCGAGCCGTCGGTGCCGGGCGGCGTATGGATCGAGGTGAGCGACG
ACGGCGACGGCATCGGCGTCGAGCCGCTCGACCGCATCTTCGAGCCGTTCTATTCAAACCGGTCCGGCGC
GCCGGGCACGGGGCTCGGCCTGGCGATCGTCGCGGGCGCGGCGATCGCGCATCGCGGGCAGATCGCCGTC
GCGACGGATCGCGGCGCGGGCAGCCGCTTCAGGCTCACGTTGCCCGCGGCGCACGGGACGGGCGCGTCGG
GCGCACCGGGAGAAGCGGACGCCGGCGCGCGCGGCGCAGTACAGGAGAAGAAACGATGA
 Primer design