SecReT6
Protein ID: 488605730
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3986
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]457135..458886 [+]
Producthypothetical protein
NoteTssF
UniProt IDN0AQ35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.80E-159, Aligned region: 6..583
Protein Sequence: 583 a.a.     [Download]
>gi|488605730|ref|YP_007920447.1| hypothetical protein BTI_3986 [Burkholderia thailandensis MSMB121]
MTTTTLNRYYEDELVRLRELAAEFGRAYPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDDGLPELV
QALANLLFPHSLCPVPAATLIAFEPRGALRERAVIAAGTEIESTPVDGTACRFRTCGSLDVEPVALAGCR
FVPPAEGVPALRLDFEMLGIDASEWDAARIRLFVAGERLHASRLFALLMRHVASVDIACGPPDRPGPRCA
LGSRALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELNGLERWRAARSGAQFSVWLVLDCAPD
WLAGIDRDSFRLNVAPALNLFAHEAVPIQHEHRATDYRLQPEGDAHGHCRIHSVDRVVGYRPGHPVDRHY
VPFGVAGDAGVAGDAASYRLIRRAALDGRGHDVHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDV
CRPTDSSPERFAFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGNVDNLKQMLALHAFGERGDDARA
QADRRRIDGIESVDVRAETRIVGERMLSGQHVALRCRAHAFGGAGELYLFGCVLERFLAEYAALNTYTRV
EIDASPDGGRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|488605303|ref|NC_021174.1|:457135-458886 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACCACCACCACGCTGAATCGCTATTACGAGGACGAGCTCGTCCGCCTGCGCGAGCTCGCCGCCGAGT
TCGGCCGCGCGTACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTTCTGACGGGGCTCGCGCGGCAAAAGCTCGACGACGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGTTGTTTCCGCACTCGCTCTGCCCGGTTCCGGCCGCGACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCGGTGATCGCGGCCGGCACCGAGATCGAATCGACGCCCGTCGA
CGGCACGGCCTGCCGGTTCCGCACGTGCGGCAGCCTCGATGTCGAGCCGGTCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGGAAGGCGTGCCCGCGCTGCGGCTCGATTTCGAGATGCTCGGCATCGACGCGAGCG
AATGGGATGCGGCGCGCATTCGCCTGTTCGTCGCCGGCGAGCGGCTGCACGCGAGCCGGCTGTTCGCGCT
CCTGATGCGGCACGTCGCATCGGTCGACATCGCATGCGGCCCGCCGGATCGGCCCGGCCCGCGCTGCGCG
CTCGGCAGCCGCGCGCTGCGGCCGGCGGGCTTCGACGACGCGCTGCTGCCTTGCCCCGAGCGCGCGTTCC
CCGGCTTCAGGCTGCTGCACGAGTATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGAACGGCCT
CGAGCGCTGGCGCGCCGCGCGCTCGGGCGCGCAGTTCAGTGTGTGGCTCGTGCTCGATTGCGCCCCCGAC
TGGCTGGCGGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCCCCGCGCTGAACCTGTTCGCGCACG
AGGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGACTACCGGCTGCAACCCGAAGGCGACGCGCACGG
CCACTGCCGGATACACTCGGTCGATCGCGTGGTCGGCTATCGCCCCGGCCATCCTGTTGACCGGCATTAC
GTTCCGTTCGGCGTCGCGGGCGACGCGGGTGTCGCGGGCGACGCCGCGAGCTACCGGCTGATTCGTCGCG
CGGCGCTCGACGGACGCGGGCACGACGTCCATCTGGCGCTCGCCTATCCGCCCGGCGAGGCGCTCGCGAC
GGAAACGCTGTCGATCGGCCTGTCGTGCACGAACGGCGCGCTGCCCGCGCGCCTGAAGATCGGCGACGTG
TGCCGTCCGACCGACAGCTCGCCCGAGCGCTTCGCGTTCGCGAACATCGCGCCGGTGAGCCCGCCGCTCG
ATCCGCCGCTCGGCGAGCCGCTGCTGTGGCGGACCATCGGCCATCTCGCGCTGAATTTCCTGTCACTCGG
CAACGTCGACAACCTGAAGCAGATGCTCGCGCTCCACGCGTTCGGCGAGCGCGGCGACGATGCGCGCGCG
CAAGCCGACCGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGCGCCGAGACGCGGATCGTCGGCG
AGCGGATGCTGAGCGGCCAGCACGTCGCGCTGCGCTGCCGCGCGCACGCGTTCGGCGGCGCGGGCGAGCT
GTATCTGTTCGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGCTCAACACGTATACGCGCGTC
GAGATCGATGCGTCGCCCGACGGCGGGCGCTTCGCGTGGCCACCGAGGATGGGGGCGCAATGCCTGCTCT
AG
 Primer design