SecReT6
Protein ID: 488605792
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3996
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]472890..473606 [+]
Producttype IV/VI secretion system, DotU family domain protein
NoteTssL
UniProt IDN0AJ57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-40, Aligned region: 1..225
Protein Sequence: 238 a.a.     [Download]
>gi|488605792|ref|YP_007920457.1| type IV/VI secretion system, DotU family domain protein [Burkholderia thailandensis MSMB121]
MKLSDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPEADVDDALFAVCAWIDEALMN
SGWYDADRWTLRLLQKRHFDTSHAGVVFFERLDALDGARANVLAVYLLCLQLGFRGRYGYDGGSRPLDAI
RRRALDALSAHASLPAEGEPPFPAAYPDDGYPDDGYPDDGYPDDAGHPRAAAANARTRRRIALAGLNVGL
PLAILLSLYLIYHVVIVRMVDSVFPRLQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|488605303|ref|NC_021174.1|:472890-473606 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAAGCTGTCCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGATCACGCGGCCTGCGCGGG
CGCGCCCGAAGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGATGAAC
AGCGGCTGGTACGATGCCGACCGCTGGACGCTGCGGCTGCTGCAGAAGCGCCACTTCGACACGTCGCACG
CGGGCGTCGTGTTCTTCGAGCGCCTCGACGCGCTCGACGGCGCGCGCGCGAACGTGCTCGCGGTCTATCT
GCTGTGCCTGCAGCTCGGTTTTCGCGGCCGCTACGGCTACGACGGCGGCAGCCGGCCGCTCGACGCGATC
CGGCGGCGCGCGCTCGACGCGTTGTCGGCGCATGCGTCACTGCCCGCCGAAGGCGAGCCGCCGTTCCCCG
CCGCATATCCGGACGACGGGTATCCGGACGACGGGTATCCGGACGACGGGTACCCGGACGACGCCGGACA
TCCGCGCGCCGCCGCGGCCAACGCGCGCACGCGCCGCCGCATCGCGCTCGCGGGCCTGAACGTCGGGCTG
CCGCTCGCGATCCTGCTGTCGCTCTATTTGATCTATCACGTCGTCATCGTGCGAATGGTCGACTCGGTGT
TCCCGAGGCTGCAATGA
 Primer design