SecReT6
Protein ID: 488605809
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5359
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2186180..2187541 [+]
Producthypothetical protein
NoteTssK
UniProt IDN0AF94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|488605809|ref|YP_007921799.1| hypothetical protein BTI_5359 [Burkholderia thailandensis MSMB121]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQAALRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETEFAQAGDIACLALQAARTGGPEMAFGDVASASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEAALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLATMLRQALARVIETPVLPLRFEDRGDQVHICIIDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2186180-2187541 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAGCAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCGCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGATCAGGACGGCCTCGGGCTCGGCAGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCCGACGATCCGCTGCCGCCGCCGCTCGAGACCGAGTTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCGGCGCGCACGGGCGGCCCGGAAATGGCGTTCGG
CGACGTCGCGTCGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGCCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACCGGGCAGCTCGTCACGCGCCTTTGCTGGAAGTCGC
AGTTGCGCTCCGACGAAGCCGCGCTGCCGATCGCGCGCGTGGCGGGCCGCAACGCGAGCCGCACCGTATC
GCTCGACCCGCGCTTCATTCCGCCGCTCCTCGACACGCGCGCGCATCTCGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGTTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGCG
GCGTCGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCCTCGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCCGCGATGCTGTATCACGAACTGGTCGGCCTGCTCGGGCGCCTGAGC
GTGCTGCCGGGCGTCGACGAGGAGCTCGCCGACCGCGAGCTCGGCTACGACCACGACGATCTTCAGACGA
GCTTCGAGCCGCTCGCGACGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACGCCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCATCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTCGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGCCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA
 Primer design