SecReT6
Protein ID: 488605881
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3983
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]454470..455996 [+]
Producthypothetical protein
NoteTssC
UniProt IDN0AP90
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-184, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|488605881|ref|YP_007920444.1| hypothetical protein BTI_3983 [Burkholderia thailandensis MSMB121]
MNRDTEQTTMEGEHLQSPKNDAAPHAAAPDSPASLLDELIEAARVKRDEDAYPITRQGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQVDAILHDPDFQQLESTWRSLKFLVQRTDFRENIRIQFLDVGKAAL
LDDFDDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYAASTAAMAHTPFVAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQFAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYDER
VDGGDADFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVADLPLYAYEAMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKHSDNAAFFSANSTQKPKFFGIGKEGKEAELNYRLGTQLPYIFVVNRLAHYIKV
IQRENIGTWKERGDLEQELNQWIRQYVADMDNPTEGVRSRRPLRQAEIFVSDVEGEPGWYRVDMKVRPHF
KYMGASFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|488605303|ref|NC_021174.1|:454470-455996 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGAACGACGCCGCGC
CGCACGCGGCGGCGCCCGACTCCCCCGCGTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAGGACGCGTATCCGATCACGCGCCAAGGCATCCAGGCATTCGTCGCGCATCTGGCGAAACCGAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGGTCGACGCGATCCTCCACGATCCGGATTTTCAGCAGCTCGAATCGACGTGGCGCTCGCTGAAGTT
CCTCGTCCAGCGCACGGATTTCCGCGAGAACATCAGGATCCAGTTCCTCGACGTCGGCAAGGCGGCGCTC
CTCGACGATTTCGACGATTCGCCCGACATCACGAAATCCGGCCTGTACCAGAAGGTCTACACGGCCGAGT
ACGGCCAGTTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCGGGCGCGCAGGA
CGTCAAGCTGCTGCAATACGCCGCGAGCACGGCGGCGATGGCGCACACGCCGTTCGTCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTGGCGTCGCTGTTCGAGG
GGCCGCAATTCGCGAAGTGGAACGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCCTGCTGCGGCTGCCGTATGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGACGAGCGC
GTCGATGGCGGCGACGCGGATTTCCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGGCTCACCGCGA
GCTTCGCCGACTACCGCTGGTGCGCGAACGTGATCGGCCCGAAGGGCGGCGGCACGGTCGCCGATCTGCC
GCTCTATGCATACGAGGCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAGCAGGGCTTCATCGCGCTCACGATGCGCAAGCACAGCGACAACGCCGCGT
TCTTCTCCGCCAATTCGACGCAAAAGCCGAAATTCTTCGGCATCGGCAAGGAAGGCAAGGAAGCCGAACT
GAATTACCGGCTCGGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCGCATTACATCAAGGTG
ATCCAGCGCGAGAACATCGGCACGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGCGGACATGGACAACCCCACCGAGGGCGTGCGCAGCCGCCGGCCGCTGCGCCAGGCGGA
GATCTTCGTGTCGGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCGACATGAAGGTGCGGCCGCATTTC
AAGTACATGGGCGCGTCGTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTGA
 Primer design