SecReT6
Protein ID: 488605936
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5361
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2189303..2192806 [+]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDN0APE3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.10E-69, Aligned region: 261..345
IcmF-related [PF06761], Evalue: 7.10E-69, Aligned region: 493..799
IcmF-related [PF06761], Evalue: 7.10E-69, Aligned region: 870..880
ImcF-related_N [PF14331], Evalue: 4.30E-31, Aligned region: 192..377
DUF1215 [PF06744], Evalue: 8.60E-28, Aligned region: 86..106
DUF1215 [PF06744], Evalue: 8.60E-28, Aligned region: 301..318
DUF1215 [PF06744], Evalue: 8.60E-28, Aligned region: 904..1029
Protein Sequence: 1167 a.a.     [Download]
>gi|488605936|ref|YP_007921801.1| intracellular multiplication and macrophage-killing family protein [Burkholderia thailandensis MSMB121]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKTKQLDFVDKHLRNLDQQLKERWRKEPRSRWKRGIGALTREHRAMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDFNFRITREAVWFDVGGRWSLRAGVDEGELDAWRKLLRGMRRLRKGAPI
SGVVLCVDGADMVDAPLDARKRLADSVRARLDEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLDASKWA
KGVGFSLPDDGAEADAARADATWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKALVA
WLHVALAPGETHTAARLRGVWLGSMAELAQAHPAGAAGAGSSELPVPSRPLSELWTPLIRQVSLERDAVR
PSGPKSWRGRLGGALRWSAVPIVALGLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTL
IEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARDTYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDI
YQTLKVYLMLCRPDRRSADDVVRWLDGRWDALAGGQYSDDDRRSLLAHVRTLISLKNVPATPEDANLVRS
ARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVF
VPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLD
DASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLL
PEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAAR
QPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRNAQADAGVEDFERLFSSQ
GLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGLVSQSVLSSYETADRIRGAMLDDSGHLRVSTVLRFID
MDSQLSEAQLSAAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQ
AVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2189303-2192806 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGATCCGCACGAGCTTGAGAGTTTTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TCTTCGCGTTCGGCATCTATCACCCGCTCGGCCCCGTGTGGGTGCGCGAGATCCTCGTCGCGCTCGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCAATGAGTCCGCGGCAGGTGAAG
GTCGCGCCGAAGACGAAGCAGCTCGATTTCGTCGACAAGCATTTGCGCAACCTCGACCAGCAATTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCAGCCGCTGGAAGCGCGGGATCGGCGCGCTCACGCGCGAGCATCGCGC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCGGAGGGCAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTC
AGCGTGTCCGGCTCGCTGCAGGACCGCGTGCTCGGCTCCGACGCCACTTACGGGCGCGGCGACGATTTCA
ACTTCCGGATCACGCGCGAGGCCGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGCGTCGA
CGAGGGTGAGCTCGATGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAAGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCGCCGACATGGTCGATGCGCCGCTCGATGCGCGCAAGCGCCTCG
CCGATTCGGTGCGCGCGCGGCTCGACGAAATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTCGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTGTCGACGCTGTCGCTGCTCGACGCGTCGAAGTGGGCG
AAGGGCGTCGGCTTCAGCCTGCCCGACGACGGCGCCGAAGCCGACGCGGCGCGCGCGGACGCGACGTGGC
AGCACGCGTTGCAAGGGCTGCAGCAGCGCGTCCAGCAGCAGGTGCTGTATTCGGCGCCCGCCGCGACCGA
GGTGTCGATGAACCACGCGCAATTGCGTTTCGTCGAGACGCTCAGCCGGCTGCAGAAGGCGCTCGTCGCA
TGGCTGCACGTCGCGCTCGCGCCGGGCGAAACGCATACGGCCGCGCGGTTGCGCGGCGTGTGGCTCGGCT
CGATGGCCGAGCTTGCGCAGGCGCATCCGGCGGGCGCGGCGGGCGCCGGCTCGTCGGAGCTGCCCGTGCC
GTCACGGCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGTCGCTCGAGCGCGATGCGGTGCGG
CCGAGCGGCCCGAAGTCGTGGCGCGGCCGCCTCGGCGGGGCGCTGCGCTGGAGCGCGGTGCCGATCGTCG
CGTTGGGCCTCCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGATTATCTGGACGGCGTCTGGGC
GCAGTTCACCGAGGCGAAGCGGCTCGCGCAGGCCGAGGCGTCCTATGGCAACGACGGCGGCTCGACGCTC
ATCGAGATCGCGAACCAGATGCGCTATGCGCAGTTGCAGGCCGAGGACGCCGCACAGGGGATGGCCACGC
CGTACTTCGAGCACGGGCTCGTCGCCGAGACGGCGCGCGACACCTATTACCGGCACTTGCAGAAGATGCT
GATGCCGGAGCTGTACAACGAAGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCCGGGCGACATC
TATCAGACGCTGAAGGTCTACCTGATGCTCTGTCGTCCTGATCGACGCTCGGCGGACGACGTCGTGCGCT
GGCTCGACGGCCGCTGGGACGCGCTCGCGGGCGGCCAGTACTCGGACGACGACCGCCGCTCGCTGCTCGC
GCACGTGCGCACGCTGATATCGCTGAAGAATGTGCCGGCGACGCCGGAGGACGCGAACCTCGTGCGCTCG
GCGCGCGCGAAGGCCGCGCAGATTCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCGCAGGGGCTGC
CGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCG
CAGCAACGTGCCGTCGACCGACACCGCGGTGTCCGGCTGGTTCACGCGCGCGGGCTACACGGACGTGTTC
GTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAAGAGAGCTGGGTGTTGCGCGACGAGACGC
TGTCCGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCCGCGCGCAACCAGTTCCT
TCAGGACTATATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTCGAC
GATGCGTCGCAGCTCGCGGCCGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCG
CGCGCGAGACGACGCTAACGGGCGCGAGCGACGAGGGCAACATCGATAGCTGGATCGATCGCCAGAAGTA
TCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGCCAGCATTACCGGACGGTGCTGCTG
CCCGAGCACGTCGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAGTTGAACCGCAACAACA
CGATTGCGAACAATCCGCTGTCGCGCCTGTTCGAGCCGCTGTACCGGCAGCTCGGCCTCGTCAACGGCGC
GCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGGCTGAAGGAGACGGCCGCGCGT
CAGCCGGAGCCCGTGCGCGGCATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAAT
CGGGCGCGCTGCTCAATCGCGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCG
CTATCCGATGCGCCGCAACGCGCAGGCGGATGCGGGCGTCGAGGACTTCGAACGATTGTTCAGCTCGCAG
GGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCCTATGTCGATACGTCCGCGAAGCCGTGGCAGG
CGCTGCGCTCGAACGGCGGGCCGAACGGGTTGGTCAGCCAGTCGGTCCTCAGCTCGTACGAGACGGCCGA
TCGCATCCGCGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCGCTTCATCGAC
ATGGATTCGCAGTTGTCCGAAGCGCAACTGAGCGCCGCCGGCCAGACGGTGCGCTTCGCGCACGGCGTGA
CGTCGCCGCACCGGGTCGACTGGACCAATCAGAACACGCAGCTCGCGATCAAGCTGCAACTGAAGTCCGT
CGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGGCAG
GCAGTGGGCGGCACGGGCACCGCGGACCGGCGCGAGCGGCTCTATCAGACGAGCCTCGGCACGGTCCGCA
TCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTC
GTGA
 Primer design