SecReT6
Protein ID: 488605950
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3997
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]473618..477481 [+]
ProductimcF-related N-terminal domain protein
NoteTssM
UniProt IDN0AQJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.70E-47, Aligned region: 173..417
ImcF-related_N [PF14331], Evalue: 9.70E-47, Aligned region: 864..888
ImcF-related_N [PF14331], Evalue: 9.70E-47, Aligned region: 1044..1078
DUF1215 [PF06744], Evalue: 0.0019, Aligned region: 976..1041
Protein Sequence: 1287 a.a.     [Download]
>gi|488605950|ref|YP_007920458.1| imcF-related N-terminal domain protein [Burkholderia thailandensis MSMB121]
MMIARIVALLALAALSWATALYFDWPLWSSPAVFCAALAGWLLGAIARRALRAVRARRQLARLDATERAP
ADRDAPELRVAARWRAALDALERAAPAPGLRGRPRDALPWYLVIGRTGAGKTTALARARIASPLRRARHD
AAIAPTEDCDWWCFDDAVVLDLAGRFAEPDATDGDRRAWSALLEQLGRARARRGVNGVVVAIDAPRLVEA
DRDALTIDGCAVRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRDRAFGYLGDHDADAFV
THALDSIDARLAALRVAPAARGEPPSPRALMLPHELARVRPALDAFARAAFGPNVYQETPYLRGLLFASG
RQAGGAPSLTLPDWLDAAPARAPGDAGLFLHDVFARVLPGERDAWRPVERPSRSRLTPARVALAAWLFAC
VAAGLLMSASFVGDMRTVELIRRDYPAHPRFTGELARDAATLERIGRVIADVERRDERRLVRRLAPPIAD
ATPVGRLEAELKRRYVAHYRRSIEPAADRLFFGEPDGASDARAADDGDVAARIRNLVRYVNLMQARLRGA
DRETLARMPAPAAVRARDDDGAGGKRRTSDTSGTSGTRGVGGTSDTRDTNDASGARDRGDGLPPRIGALA
VGRIAWSAPGDSALAARLAAAQAQLERLAYRDPDGAWLLALPDATMPRDVTLADFWPAAAPPAPPALPAA
QPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDAWYRARRIDTWRDFVARFPQGEQ
GLTTQAQWRAVIDRIPDRRDPFSALLARVDREFESVRDDALPPWLRFVRTASHMLAPARLPAASGGLGAT
LGSISRSGGRALREALGGAPAQGRLTLERDAALRNALVDYERRVAALAADALAGPGAAYRLAADFHGFGV
DPSVEASAMRAADDALRDVKRLAGGRDVGGDVVWSLVGGPLHAVIAYVERQASCALQDDWERDVLWPLRR
AATHDDANDRLYGPQGAIWAFVDGPAKPFVRVGAARAAAADTLGYRLPFTDAFLPLVDDAAARRVAQARR
EAERRAQQQAAAELDERIASLGKQIDALNAQTVRIGIVAQPTDVNREAQAKPFETVLTLQCAPQARTLTN
YNLRVSEQIDWQPDRCGDATLRIALGGVTLVRRYAGPLGVARFVQDFRYGVRRFAPGDFPDAKAQLERLG
VRYVDVRYDFSGHDALLAHVERIDALERERRDDIARQRRAASRQDDGAGAGGSAANVARASSASSTPGAV
DAALPRRIGACWGDPARDGPDGGGARP
 
Nucleotide Sequence: 3864 bp     [Download]
>gi|488605303|ref|NC_021174.1|:473618-477481 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGATGATCGCGCGGATCGTCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGACCGCGCTCTACTTCG
ACTGGCCGCTGTGGAGCTCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGGGTGCCATCGC
GCGCCGCGCGCTGCGCGCCGTTCGCGCGCGCAGGCAGCTCGCGCGGCTCGATGCGACTGAGCGCGCGCCC
GCCGATCGCGACGCGCCGGAGCTACGCGTCGCCGCGCGCTGGCGCGCAGCGCTCGACGCACTCGAACGCG
CCGCGCCCGCGCCGGGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCCTGGTATCTCGTGATCGGCCGCAC
GGGCGCGGGCAAGACGACGGCGCTCGCGCGCGCGCGCATCGCGTCGCCGCTGCGGCGCGCGCGCCACGAC
GCGGCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGACCTCGCGG
GCCGCTTCGCCGAGCCCGACGCGACCGACGGCGACCGCCGCGCATGGAGCGCGCTCCTCGAGCAGCTCGG
CCGCGCGCGTGCGCGCCGGGGCGTCAACGGCGTCGTCGTCGCGATCGACGCGCCGCGCCTCGTCGAAGCG
GATCGCGACGCGCTGACGATCGACGGCTGCGCGGTCCGCGAGCGGCTCGAGCAACTGATCCGCCTGTTCG
ACCGGCGCTTTCCGGTCTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGC
GCAGCTCGCGCCGGAACAACGCGATCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTC
ACACACGCGCTCGACAGCATCGACGCGCGGCTCGCCGCGCTGCGCGTCGCGCCGGCGGCGCGCGGCGAGC
CGCCTTCGCCGCGCGCGCTGATGCTGCCGCACGAGCTCGCGCGCGTGCGGCCCGCGCTCGATGCGTTCGC
GCGCGCGGCGTTCGGCCCGAACGTCTATCAGGAGACGCCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGC
CGGCAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCGCGCCCG
GCGACGCGGGCCTGTTCCTGCACGACGTGTTCGCACGCGTGCTGCCGGGCGAGCGCGACGCATGGCGGCC
CGTCGAGCGGCCGAGCCGCTCGCGGCTGACGCCGGCGCGCGTCGCGCTGGCCGCATGGCTCTTCGCGTGC
GTCGCGGCCGGGCTGCTGATGAGCGCGTCGTTCGTCGGCGACATGCGGACCGTCGAGCTGATCCGCCGCG
ACTATCCCGCGCATCCGCGCTTCACGGGCGAGCTCGCGCGCGATGCGGCGACGCTCGAGCGAATCGGCCG
CGTGATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGGCGGCTCGCGCCCCCGATCGCCGAC
GCGACGCCCGTCGGCCGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCATTATCGGCGCTCGATCG
AGCCCGCCGCCGATCGGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACGCGCGCGCGGCTGACGACGG
CGATGTCGCCGCGCGCATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCTGCGCGGCGCG
GATCGCGAGACGCTCGCGCGGATGCCCGCGCCGGCGGCCGTGCGCGCGCGGGATGACGACGGCGCAGGCG
GCAAGCGGCGCACAAGCGACACAAGCGGCACAAGCGGCACGCGTGGCGTCGGCGGCACGAGCGACACCCG
CGACACGAACGACGCAAGCGGCGCGCGCGATCGCGGCGACGGGCTGCCGCCGCGCATCGGCGCGCTCGCC
GTCGGCCGGATCGCGTGGAGCGCGCCCGGCGACAGCGCGCTCGCCGCACGGCTCGCGGCCGCTCAGGCGC
AGCTCGAACGGCTCGCGTACCGCGACCCGGACGGCGCGTGGCTGCTCGCGCTGCCCGACGCAACGATGCC
GCGCGACGTGACGCTCGCCGACTTCTGGCCGGCCGCCGCGCCACCCGCGCCACCCGCGCTGCCTGCCGCT
CAACCCGCCGCGCTGCGCGACGTGCGCGTGCCTGCCGCGCTGACGGCCGCGCATCGTCCGGCGATCGACG
CGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCATTCGA
TGCGTGGTATCGCGCGCGGCGCATCGACACCTGGCGCGACTTCGTCGCGCGCTTCCCGCAGGGCGAGCAA
GGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGATTCCCGATCGCCGCGATCCGTTCTCGG
CGTTGCTCGCACGCGTCGATCGCGAATTCGAATCCGTGCGCGACGACGCGCTGCCGCCGTGGCTGCGCTT
CGTCCGGACGGCGTCGCACATGCTCGCGCCCGCGCGATTGCCCGCGGCGAGCGGCGGCCTCGGCGCGACA
CTCGGCTCGATCTCGCGCAGCGGCGGCCGCGCGCTGCGCGAGGCACTCGGCGGCGCGCCCGCGCAAGGCC
GGCTCACGCTCGAGCGCGACGCCGCATTGCGCAACGCGCTCGTCGACTACGAGCGGCGCGTCGCCGCGCT
CGCCGCCGACGCGCTCGCGGGGCCCGGCGCCGCCTACCGGCTCGCGGCCGACTTCCACGGCTTCGGCGTC
GATCCGTCGGTGGAAGCATCCGCGATGCGCGCAGCCGACGATGCGCTGCGCGACGTCAAGCGGCTCGCGG
GCGGTCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCACGCGGTGATCGCGTA
TGTCGAGCGGCAGGCGTCGTGCGCGCTGCAAGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGC
GCGGCGACGCACGACGACGCCAACGACCGGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACG
GCCCGGCGAAGCCGTTCGTGCGCGTCGGCGCGGCGCGCGCGGCGGCGGCCGACACGCTCGGCTACCGGCT
GCCGTTCACCGATGCGTTCCTGCCGCTCGTCGACGACGCGGCCGCCCGGCGCGTCGCGCAGGCGCGGCGC
GAAGCCGAGCGGCGCGCGCAACAGCAGGCGGCGGCCGAGCTCGACGAGCGGATCGCGTCGCTCGGCAAGC
AGATCGACGCGCTCAACGCGCAGACGGTGCGCATCGGGATCGTCGCGCAGCCGACCGACGTGAACCGCGA
AGCGCAGGCCAAGCCGTTCGAGACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAAC
TACAACTTGCGCGTGTCCGAGCAGATCGACTGGCAGCCCGATCGATGCGGCGACGCGACGCTGCGCATCG
CGCTCGGCGGCGTCACGCTCGTGCGCCGGTACGCGGGGCCGCTCGGCGTCGCGCGCTTCGTCCAGGACTT
CCGCTACGGCGTGCGGCGCTTCGCGCCCGGCGATTTTCCGGACGCGAAAGCGCAGCTCGAACGCCTCGGC
GTGCGCTACGTCGACGTGCGTTACGACTTCTCGGGGCATGACGCGCTGCTCGCGCACGTCGAGCGGATCG
ACGCGCTCGAGCGCGAGCGCCGCGACGACATCGCGCGGCAGCGGCGCGCCGCGAGCCGGCAGGACGACGG
GGCGGGCGCGGGCGGCTCCGCGGCGAACGTTGCACGCGCGTCGTCTGCGTCGAGCACACCGGGCGCGGTG
GACGCCGCGCTGCCCCGCCGCATCGGCGCGTGCTGGGGCGACCCGGCTCGCGACGGGCCCGACGGCGGCG
GCGCGCGTCCGTGA
 Primer design