SecReT6
Protein ID: 488606092
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4910
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1632440..1633822 [+]
Producthypothetical protein
NoteTssK
UniProt IDN0AJY2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-159, Aligned region: 30..459
Protein Sequence: 460 a.a.     [Download]
>gi|488606092|ref|YP_007921357.1| hypothetical protein BTI_4910 [Burkholderia thailandensis MSMB121]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGGDGNGNADAGFARY
VVREHEVADANEVALGPALLQTGRLNVRLMLESELTGDWEALGAVRIVERRTDGRLLVDDGYIPPRLVAQ
RDPVLLRHTRELHGLLTQRSEALGGRLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETLFR
DWLKLACDLSTFTAVGRRPQSLAVYRHDDLRTSFGELMAELRRSLSTVLEQNAIQIELRDAGNGMKVATI
ADPALRDTAGFVLAVRADVPADSLRVRFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQIPYHAGHT
YFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1632440-1633822 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGCCCGCAGCATTTCCAGCAGCTCGAGCGGCATTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAGGGCTTCTACTGGGGCTACGACGAACTGCAGATCGACCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTTGCCGCAACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGATC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGACCAGCTCGTCGTGCTCGCGTTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGGGGACGGCAACGGCAATGCGGACGCGGGATTCGCGCGCTAC
GTCGTGCGCGAGCACGAGGTCGCCGACGCGAACGAGGTCGCGCTCGGCCCCGCGCTCTTGCAGACCGGGA
GGCTGAACGTGCGGCTGATGCTCGAATCGGAGCTGACGGGCGACTGGGAGGCGCTCGGCGCCGTGCGGAT
CGTCGAGCGGCGCACCGACGGGCGGCTGCTCGTCGACGACGGCTACATTCCGCCGCGGCTCGTCGCGCAG
CGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCACGCAGCGCAGCGAGGCGCTCG
GCGGGCGGCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGATTTCCTGCTGCTGCAACTCGT
CAACCGCTATCTGGCGCTTACGTGGCACGCGCAGCAGGACGTCGCCGCGCATCCGGAGACGCTGTTCCGC
GACTGGCTCAAGCTCGCGTGCGACCTGAGCACGTTCACCGCGGTGGGCCGGCGGCCGCAGTCGCTCGCCG
TCTATCGGCACGACGATCTGCGCACGAGTTTCGGCGAGCTGATGGCGGAGCTGCGCCGCTCGCTGTCGAC
GGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGCGGGCAACGGAATGAAGGTCGCGACGATC
GCCGATCCGGCGCTGCGCGACACCGCGGGCTTCGTGCTCGCGGTGCGCGCCGACGTGCCGGCCGACAGCC
TGCGCGTGCGTTTTCCCGCGCAGGCGAAGCTCGGGCCCGTCGAGCGGATTCGCGACCTCGTGCAGTTGCA
GTTGCCGGGCATCGCGATGCGGCAACTGCCGGTCGCGCCCCGGCAGATTCCGTATCACGCGGGGCACACG
TACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAGCAGCTCGAACGCTCCGGCGGCCTCGCATTTCATT
TCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGGGTGA
 Primer design