SecReT6
Protein ID: 488606190
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4907
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1629447..1630814 [-]
ProductFHA domain protein
NoteFha
UniProt IDN0ARB4
KEGG IDbtd:BTI_4907
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-10, Aligned region: 29..96
Protein Sequence: 455 a.a.     [Download]
>gi|488606190|ref|YP_007921354.1| FHA domain protein [Burkholderia thailandensis MSMB121]
MQLTVIEHAGEPVGTDDRNAVVFHPPGGTIGRDSDNHLVLRDDTRQISRLQALLQVAGDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAAASHAQTKGASNKLWGLLHDRFGL
GRTQDADGKAVERPGAAPPRDRDSPASAAPRDLHQLSTDPLDLFAQPQGDLDAQAGAARDGDGRGPPTSS
VTQSDHAPEWTQHVRVQPAKSAPPAAARPGDAGDVPSRVHASTPATPETLLQAFFEGAGLDTAAEPHHWS
AEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLKLLPDGGAVLRQMFGLPLPGFMT
PQSAVSDAFQDLHAHQLGMVAGMRAALMDLLTRFSPQRLRERDTAPQWYEKRVPALYKARLWDRYATTHR
DTLFAIEDDFASVFGKAFLSAYDAEVEGYRGRCRR
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1630814-1629447 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGACCGCAACGCCGTCGTGTTTC
ATCCGCCGGGCGGCACGATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAGAT
CTCGCGCCTGCAGGCGCTGCTGCAAGTGGCCGGCGACGCATGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAGGTGAACCGCGTGCCGATCGGCTATGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCGTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGGACCGTCGAAGCGGCGGC
CGCCTCGCACGCGCAGACAAAGGGCGCGAGCAACAAGCTGTGGGGCCTGCTGCACGATCGTTTCGGGCTC
GGCAGGACGCAGGACGCGGACGGCAAGGCCGTCGAGCGGCCTGGCGCCGCGCCGCCGCGCGATCGCGATT
CGCCGGCGTCCGCCGCGCCGCGCGACCTGCATCAGCTATCGACCGATCCGCTCGATCTGTTCGCGCAGCC
GCAGGGCGATCTCGATGCGCAGGCCGGCGCCGCGCGAGACGGCGACGGGCGCGGGCCGCCAACCTCATCC
GTCACGCAATCGGATCACGCGCCCGAATGGACGCAACATGTGCGCGTGCAGCCGGCGAAGTCCGCGCCGC
CCGCCGCCGCGCGTCCGGGCGACGCGGGCGACGTGCCGTCGCGCGTGCACGCATCGACGCCGGCGACGCC
CGAGACGCTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCGGCCGAGCCGCACCACTGGTCC
GCCGAGCAGTTGTTCGTCGCGGGGCAACTGCTTGCGCTGTTCGCGAACGGCACGGTCGAGCTGCTGTCGT
CGCGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAACCCGCT
GAAGCTGCTGCCGGACGGCGGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGTTTCATGACG
CCGCAAAGCGCGGTGTCCGACGCGTTCCAGGATCTGCACGCGCATCAGCTCGGCATGGTGGCCGGCATGC
GCGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACACCGCGCCGCA
GTGGTACGAGAAGCGCGTGCCCGCGCTGTACAAGGCGCGCTTGTGGGACCGCTATGCGACCACGCATCGC
GACACGCTGTTCGCGATCGAAGACGATTTTGCTTCCGTGTTCGGCAAGGCGTTCCTTTCCGCCTACGACG
CGGAAGTCGAGGGCTATCGCGGGCGCTGCCGACGCTGA
 Primer design