SecReT6
Protein ID: 488606192
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5348
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2170334..2170765 [+]
Productlysozyme family protein
NoteTssE
UniProt IDN0AKB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.70E-12, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|488606192|ref|YP_007921788.1| lysozyme family protein [Burkholderia thailandensis MSMB121]
MSDLQLYNKLSRRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQTAGATKINP
VHAAAHICEVIRRFEPRVDPVATTVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2170334-2170765 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAGCGATCTTCAACTCTACAACAAGCTGTCGAGACGGATTCGTCGCCATTCGCTTCAAGAGGTCGTCG
CCGATCACCTGGTCGACCTGATGAATCACGCGATCCGCGGCGCGCGCATGCGTATCGCGGACGACAGCCC
GGCGGCGCATTCGGTGTTGAACTTCGGCTGTCCGCCGATGCAGACGGCCGGCGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCACATCTGCGAGGTGATTCGTCGCTTCGAGCCGCGCGTGGATCCCGTCGCCACGA
CGGTCAAGCCTCGGACCGAGAGCCGCAAGCGTCTCGCGCAGACGATCTATTTCGATGTGTCGATGAAGGC
GCGCGAAGACGGAGCCGAGCTCAGGGCGAGCCTCGCGCTCGATTACCTGAGCGGCTATTTCAGCCTGGCG
GACGACCGATGA
 Primer design