SecReT6
Protein ID: 488606320
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3995
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]471496..472893 [+]
Producthypothetical protein
NoteTssK
UniProt IDN0ARN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-95, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|488606320|ref|YP_007920456.1| hypothetical protein BTI_3995 [Burkholderia thailandensis MSMB121]
MDNIYWHQGMLLQPQHFQLAELHQQFRVEPWLASGPPHFWGVGALSLAQAAIDRRAVEIRSAHLLFSDRS
YVEYPGNAVVAARAFDPAWLDDGRALVVHVALRRLARGANNVTVASTPDALPDAATRYATLPCADEVGDL
YSDQPGAPVRTLKHVLKIVFGHELDALAGHETIPIARIVRDGERLRLDDDFAPPCYALTGARALLDRVRC
IRDELAGRARQLQQYKNPREMQRAEFDAGYAALLLALRSLNRFGPLLFHLAECDRLHPWTVYGVLRQLVG
ELSAFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHVLIGHLLDEIAVGPDCVATFEPDGERQPAQRS
ARLPPDVFADRHLIYVAIRSAHDPDTLAQRFLLGGRIAATDEMPQLTALALPGVELTRLPGAPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRISLRWADAPDDLHAELIAVRHAS
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|488605303|ref|NC_021174.1|:471496-472893 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGACAACATCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCATC
AGCAGTTCCGCGTCGAGCCGTGGCTCGCGTCCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGCGGTCGAGATCCGCTCGGCGCACTTGCTCTTTTCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGACGGCC
GCGCGCTCGTCGTGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTGGCGTCCAC
GCCCGACGCGCTGCCCGACGCCGCGACGCGCTACGCGACGCTGCCGTGCGCCGACGAGGTCGGCGACCTC
TATTCGGACCAGCCGGGCGCGCCGGTGCGCACGCTCAAGCATGTGCTGAAGATCGTGTTCGGGCACGAGC
TCGACGCGCTCGCCGGGCACGAGACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGACTGCGGCT
CGACGACGATTTCGCGCCGCCGTGCTATGCGCTGACGGGCGCGCGCGCCTTGCTCGACCGGGTCCGCTGC
ATCCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAGCGCG
CCGAGTTCGACGCGGGCTACGCGGCGCTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACCGGCTGCATCCGTGGACGGTCTACGGCGTGCTGCGCCAGCTCGTCGGC
GAGCTGAGCGCGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACACCCGACGCGCGCGGCGGCCTGCCGC
CGTATGACCACCGCGATCTCGGCGGCTGCTTCTCGCGCGCGCACGTGCTGATCGGCCATCTGCTCGACGA
AATCGCGGTCGGCCCCGACTGCGTCGCGACGTTCGAGCCCGACGGCGAGCGGCAGCCCGCGCAACGGTCC
GCGCGACTGCCGCCCGACGTGTTCGCGGATCGCCATCTGATCTATGTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCCTGCTGGGCGGCCGGATCGCGGCGACCGACGAGATGCCGCAGCTCAC
CGCGCTCGCGCTTCCCGGCGTCGAGCTGACCCGCCTGCCCGGCGCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGGCCGTGGGACGCGATCCGGCGCGACGGCCGCATCT
CGCTGCGCTGGGCCGATGCGCCGGACGACCTGCACGCGGAACTCATCGCAGTGAGGCACGCATCATGA
 Primer design