SecReT6
Protein ID: 488606385
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3980
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]451180..451914 [-]
Producttranscriptional regulatory, C terminal family protein
NoteVirG
UniProt IDN0ARS8
KEGG IDbtd:BTI_3980
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.20E-20, Aligned region: 9..116
Trans_reg_C [PF00486], Evalue: 1.40E-19, Aligned region: 160..234
Protein Sequence: 244 a.a.     [Download]
>gi|488606385|ref|YP_007920441.1| transcriptional regulatory, C terminal family protein [Burkholderia thailandensis MSMB121]
MNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAADSVERREYEMVLLDLGLPDGDGIDVLL
RWRDSQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAY
RFDGWTLNMNTRRLSTRDAQDVPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRL
RKKIEKNPKHPELIRTERGVGYYFAATNVETLWE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c451914-451180 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAATGCGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAGCCGTTGCGGCGCGTGCTCTGCA
ATTACCTGTCGGGCCACGGCATGGCCGTGGACGGCGTGGGGACGGCAGCCGCGGCCGCCGATTCGGTCGA
GCGGCGCGAATACGAAATGGTGCTGCTCGACCTCGGTTTGCCGGATGGAGACGGCATCGACGTGCTGCTG
CGCTGGCGCGATTCGCAGCGCTTTCCGCTCATCTGCGTGACGGGCCGAAGCGAAGAGGCCGATCGCATCA
TGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCGCGGAT
GCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACAACGCCCGTGCGGCGCGGCAGGCATCCGCGCGCATAC
CGTTTCGACGGCTGGACGCTGAACATGAACACGCGCCGGCTGTCGACGCGCGACGCGCAGGACGTTCCGC
TGACAGTCGGCGAATTCAATCTGCTGGCGTTTTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGTGCGCA
GTTGCTCGAGTGCACGCGCGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGGCTG
CGCAAGAAGATCGAGAAGAATCCGAAGCATCCCGAACTGATTCGAACGGAGCGCGGCGTCGGCTACTACT
TCGCCGCGACGAACGTGGAGACGCTATGGGAATGA
 Primer design