SecReT6
Protein ID: 488606538
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5350
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2172635..2173624 [+]
Producthypothetical protein
NoteTssG
UniProt IDN0AJ87
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-57, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|488606538|ref|YP_007921790.1| hypothetical protein BTI_5350 [Burkholderia thailandensis MSMB121]
MTTLERVTQALTPRRTFFELMRRVEALQRRHDKRSARRRRMPKWLRIEQPAEMHFASTEVERVHVALARF
IEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADARRAQQGDGEPFEQHALACRRAFPGIYCAPRRSLADLQRLLCAYFGVALRV
VPRHGRWVPVPAAPSRARRLGGWRLGARIWDVQHSVEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2172635-2173624 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACGACGCTCGAGCGCGTGACCCAGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGGG
TCGAAGCGCTGCAGCGCAGGCACGACAAGCGCTCGGCGCGCAGGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGGAGATGCATTTCGCGAGCACGGAAGTCGAGCGCGTGCACGTGGCGCTCGCGCGCTTC
ATCGAGGACGACGACCACCCGCAGGTCACGGTGGCCCAGCGTCACTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGTTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCGGCGTTCGAGCG
CTTCGTCAACGTCGCGTGCGGCGATCTCGCATGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGCGTCGCGCGC
AGCAGGGCGACGGCGAGCCGTTCGAGCAGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGCCGCTCGCTCGCCGATCTGCAGCGGCTGCTGTGCGCGTACTTCGGCGTCGCGCTGCGGGTC
GTGCCGCGCCACGGCCGCTGGGTGCCGGTGCCGGCCGCGCCGAGCCGCGCGCGGCGGCTCGGCGGATGGC
GGCTCGGCGCGCGGATCTGGGATGTGCAGCACTCGGTCGAGATCGTCGTCGGTCCGATCGAGGCCGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCCGCGGTCGTGACGGATTTCGTCGAC
GGACGAATTTACCCCGTCATCAAGGTTCAGGTATGGACGCGCCCTGAGCTTGCAGGAAGGGTTGGGTGCA
TGCGCGTCGGCGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG
 Primer design