SecReT6
Protein ID: 488606693
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4915
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1642008..1643096 [+]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDN0AJR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-22, Aligned region: 56..116
Protein Sequence: 362 a.a.     [Download]
>gi|488606693|ref|YP_007921362.1| impA-related N-terminal family protein [Burkholderia thailandensis MSMB121]
MQSSDPIESLLAGVAPDLPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELSGR
TKDLRVAAHLARSWTELRGIPGYADGLKLVAGMLALWWDDVHPRLDADGDRDPTLRANALAEVAGAHGCA
RAARRQALFDGGPSVRDAERAFDGRDGGAEGYPGGRERLIADLVRARDGGQPTLRAAFAALDALDAIRAC
VASKLGDEWAPDASDFEKALRRIVRDGLPPPLGTPQAGAADATAGAATGAGNGAANGAANGAANGAANGA
AAPAFAANGRAWRDAEVTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESL
PKLDMLSGQRSE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1642008-1643096 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCAGAGTTCAGATCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACTTGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAAAGCGCGACGCCGCGGCCCGAGCAGCAATACGGCGA
CACCGTGATTCCGGCCGAGGCGCCCGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGTCGGGGCGC
ACGAAGGATCTGCGCGTCGCCGCGCATCTCGCGCGTAGCTGGACCGAGTTGCGCGGCATTCCCGGCTATG
CGGACGGGCTGAAGCTCGTCGCGGGGATGCTCGCGCTGTGGTGGGACGACGTTCATCCGCGCCTCGACGC
CGACGGCGACCGCGATCCGACGCTGCGCGCGAACGCGCTCGCCGAAGTCGCGGGCGCGCACGGCTGCGCG
CGCGCCGCGCGCCGGCAGGCGCTCTTCGACGGCGGCCCGAGCGTGCGCGACGCCGAGCGTGCGTTCGACG
GCCGGGACGGCGGCGCGGAAGGCTATCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTGCGCGCGCG
CGACGGCGGGCAGCCGACGTTGCGGGCGGCATTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGTGC
GTCGCATCGAAGCTCGGCGACGAATGGGCGCCGGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGCTGCCGCCGCCCTTGGGCACGCCGCAGGCGGGCGCGGCCGACGCGACGGCGGGCGCGGC
AACCGGCGCGGGAAACGGCGCGGCAAACGGCGCGGCAAATGGCGCGGCAAATGGCGCGGCGAATGGCGCG
GCCGCGCCGGCCTTCGCCGCGAACGGCCGCGCATGGCGCGACGCCGAGGTGACGAGCCGCGACGACGTGC
AGCTCGGCCTCGAAAAGATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCACCCGGCGCCGATCCTGCT
GCGCCGCGCGCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCTCCGGAGAGCCTG
CCGAAGCTCGACATGCTGAGCGGCCAGCGCAGCGAATGA
 Primer design