SecReT6
Protein ID: 488606698
SecReT6 ID762
T6SS typei3
Gene symbolclpV
Locus tagBTI_5351
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2173627..2176479 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDN0AJS3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-34, Aligned region: 227..249
AAA_2 [PF07724], Evalue: 1.30E-34, Aligned region: 599..765
AAA [PF00004], Evalue: 2.60E-16, Aligned region: 228..333
AAA [PF00004], Evalue: 2.60E-16, Aligned region: 604..689
AAA_5 [PF07728], Evalue: 1.90E-11, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 1.90E-11, Aligned region: 604..708
AAA_16 [PF13191], Evalue: 5.00E-10, Aligned region: 205..250
AAA_16 [PF13191], Evalue: 5.00E-10, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 5.00E-10, Aligned region: 598..625
AAA_16 [PF13191], Evalue: 5.00E-10, Aligned region: 619..698
AAA_16 [PF13191], Evalue: 5.00E-10, Aligned region: 816..865
Clp_N [PF02861], Evalue: 1.80E-07, Aligned region: 23..72
Clp_N [PF02861], Evalue: 1.80E-07, Aligned region: 111..129
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 228..333
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 602..624
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 664..688
ClpB_D2-small [PF10431], Evalue: 9.80E-07, Aligned region: 771..844
ClpB_D2-small [PF10431], Evalue: 9.80E-07, Aligned region: 852..869
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 207..248
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 604..704
Zeta_toxin [PF06414], Evalue: 3.90E-06, Aligned region: 222..252
Zeta_toxin [PF06414], Evalue: 3.90E-06, Aligned region: 603..645
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 11..50
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 228..248
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 605..639
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 228..256
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 603..634
AAA_18 [PF13238], Evalue: 6.90E-05, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 6.90E-05, Aligned region: 605..630
SRP54 [PF00448], Evalue: 0.00013, Aligned region: 228..260
SRP54 [PF00448], Evalue: 0.00013, Aligned region: 603..628
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 222..247
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 604..622
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 717..747
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 222..245
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 602..636
AAA_19 [PF13245], Evalue: 0.00019, Aligned region: 225..249
AAA_19 [PF13245], Evalue: 0.00019, Aligned region: 602..625
AAA_19 [PF13245], Evalue: 0.00019, Aligned region: 835..853
AAA_25 [PF13481], Evalue: 0.00049, Aligned region: 228..251
AAA_25 [PF13481], Evalue: 0.00049, Aligned region: 599..622
Torsin [PF06309], Evalue: 0.00088, Aligned region: 230..249
Torsin [PF06309], Evalue: 0.00088, Aligned region: 560..626
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 15..35
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 119..149
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 228..253
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 603..624
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 605..625
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 219..303
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 604..619
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 206..247
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 280..377
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 603..625
Protein Sequence: 950 a.a.     [Download]
>gi|488606698|ref|YP_007921791.1| type VI secretion ATPase, ClpV1 family [Burkholderia thailandensis MSMB121]
MNRERIFNCLGRTTYAALVDATALGRSRRHAFIDLDHWALCLLQREQSDLARLFEQFGSDVGEAKRRMEK
ALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAAKVRSGHLLLAWLDEDLTRRWLQQRVPSGITSVA
LDEVVKRYEALAAGWPETDEAPAAAGGGALGEHAGEAGAEGASDALVKWATCVTEQAARGELDPVVGRDD
ELRTVIDILSRRRQNNPILVGEAGVGKTAVVEALAQKIHAGAVPPGLIGAQVWALDLARMQAGAGVRGEF
EQRLKSLIDAVIASPAPIILFCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQYIEP
DAALVRRFQAVPVDEPGDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAISLLD
TACARVAMSQNCAPAELERLRHQAFAIGQTLDWRASDRRMGVRTPGDEAGLEGRRASLVQQASTLETVVG
AQRDEVRSWLARLNDETHVSADSDGDGDSFAVRIGANRWVRPWVDEHVVSEVLAEWTGVPVAQLAQDDAQ
RVVELEGALNAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLGVMLLAGPTGTGKSQAAAKLAELLFGGER
NLLQFNMNEFQEAHAVSTLKGAPPGYVGYGKGGRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQG
WMEDGEGRRISFRNCLILLTSNLGDVEIEAACKADPRISQAKLDKLVGERLQGRFSPALLARIQLVAFRP
LDIDALTGVATQALDELGERLAENDLQWRADEGVASWVAHAVSQHPANGRAVRDLLRQHVMPAVARGVLA
ARAEGRALKTVRLAAHEKLSLVFDEDAWELSGTDAAALGEQADAAAREAAAAAQARDAHEDAHGTPESHD
AHEAIGGARADAGDEPQADAHRSDETTSANAGTTGEPSCV
 
Nucleotide Sequence: 2853 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2173627-2176479 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
GTGAATCGCGAACGCATATTCAACTGTCTCGGCCGCACGACCTATGCGGCCCTCGTCGATGCGACGGCGC
TAGGCCGATCCCGTCGGCACGCCTTCATCGATCTCGATCACTGGGCGCTGTGCCTGCTGCAGCGCGAGCA
GAGCGATCTCGCCCGGCTGTTCGAGCAGTTCGGCAGCGATGTCGGCGAAGCGAAGCGCCGGATGGAGAAG
GCACTCGACGGCTTCGACGTCAGCGGCGACTCGCTGCGCGACATCTCCAGCTCGCTCGAGCGCAGCGTCG
GGCCGGCCGTCATCTGGAGCCAGATCGCGGCGCGCGCGGCCAAGGTGCGCTCCGGCCACCTGCTGCTCGC
GTGGCTCGACGAGGATCTGACGCGCCGCTGGCTGCAGCAGCGCGTGCCGAGCGGCATCACGTCGGTCGCG
CTCGACGAAGTGGTGAAGCGCTACGAGGCGCTCGCGGCCGGCTGGCCGGAGACCGACGAAGCGCCCGCCG
CGGCCGGCGGCGGCGCGCTCGGCGAGCATGCGGGCGAAGCCGGCGCCGAAGGCGCGAGCGACGCGCTCGT
GAAATGGGCGACGTGCGTGACCGAGCAGGCCGCGCGCGGCGAGCTCGATCCCGTCGTCGGCCGCGACGAC
GAATTGCGCACGGTGATCGACATCCTGTCGCGCCGCCGGCAGAACAACCCGATCCTCGTCGGTGAGGCGG
GCGTCGGCAAGACGGCCGTCGTCGAGGCGCTCGCGCAGAAGATCCATGCGGGCGCAGTGCCGCCGGGCCT
CATCGGCGCGCAGGTATGGGCGCTCGATCTCGCGCGGATGCAGGCGGGCGCGGGCGTGCGCGGCGAGTTC
GAGCAGCGGCTGAAATCGCTGATCGACGCGGTGATCGCGTCGCCCGCTCCGATCATCCTGTTCTGCGACG
AGACGCACACGCTGATCGGCGCGGGCGGCGCGGCCGGCACGGGCGACGCGGCGAACCTGATCAAGCCGAT
GCTCGCGCGCGGCCAACTGCGGATGGTCGCCGCGACGACGTGGTCCGAATACAAGCAGTACATCGAGCCG
GACGCCGCGCTCGTGCGGCGCTTCCAGGCGGTTCCCGTCGACGAGCCGGGCGACGACGCGGCGGTCGACA
TGCTGCGCACGATCGCGCCGCGCTTCGCCGCGCATCACGGCGTGCGCATCGTCGATTCGGCGCTGCGCGG
TGCGGTCGAGCTGTCGCGCCGCTATCTGCCCGCGCGGCAACTGCCGGACAAGGCGATCAGTCTGCTCGAC
ACCGCGTGCGCGCGCGTTGCGATGAGCCAGAACTGCGCGCCCGCCGAGCTCGAGCGTTTGCGGCATCAGG
CGTTCGCGATCGGCCAGACGCTCGATTGGCGCGCGAGCGACCGCCGGATGGGCGTGCGCACGCCGGGCGA
CGAAGCCGGGCTCGAAGGCCGCCGCGCGAGCCTCGTGCAGCAGGCGTCGACGCTCGAGACGGTGGTCGGC
GCGCAGCGCGACGAAGTGCGGTCGTGGCTCGCGCGCCTGAACGATGAAACGCATGTGTCGGCCGATAGCG
ACGGCGACGGCGATTCGTTCGCCGTGCGCATCGGCGCGAATCGCTGGGTGCGTCCGTGGGTCGACGAGCA
CGTCGTGTCGGAGGTGCTCGCCGAATGGACGGGCGTGCCCGTCGCGCAGCTCGCGCAGGACGACGCGCAG
CGCGTCGTCGAGCTCGAGGGCGCGCTGAACGCGGGCATCCACGGGCAGACGGGCGCGATGCGCTCGATCG
CGCAGGCGCTGCAGGTGTCGCACTCGGGGCTCAACGATCCGCGCCGGCCGCTCGGCGTGATGCTGCTCGC
CGGCCCGACCGGCACCGGCAAGAGCCAGGCGGCCGCGAAGCTCGCCGAGCTGTTGTTCGGCGGCGAGCGC
AACCTGTTGCAGTTCAACATGAACGAATTCCAGGAAGCGCACGCGGTGTCCACGCTCAAGGGCGCGCCGC
CCGGATACGTCGGCTACGGCAAGGGCGGGCGCCTGACCGAGGCGGTGCGCAAGAAGCCGTATAGCGTGCT
GCTGCTCGACGAATTCGATCGCGCGCATCCGGACATTCATGAGGTGTTCTATCAAGTCTTCGATCAGGGC
TGGATGGAGGACGGCGAAGGCCGCCGGATCAGCTTCCGCAACTGCCTGATCCTGCTGACGAGCAATCTCG
GCGACGTCGAGATCGAAGCGGCGTGCAAAGCCGATCCGCGGATTTCGCAGGCGAAGCTCGACAAGCTCGT
CGGCGAGCGGCTGCAAGGGCGCTTCTCGCCCGCGCTGCTCGCGCGGATCCAGCTCGTCGCGTTCCGCCCG
CTCGACATCGACGCGCTGACCGGCGTCGCGACGCAGGCGCTCGACGAGCTCGGCGAGCGCCTGGCCGAGA
ACGATCTGCAATGGCGTGCGGACGAAGGCGTCGCGTCGTGGGTCGCGCACGCGGTGTCGCAGCATCCGGC
GAACGGCCGCGCGGTGCGCGATCTGCTGCGCCAGCACGTGATGCCGGCCGTCGCGCGCGGCGTGCTCGCC
GCGCGGGCGGAAGGGCGCGCGCTGAAGACGGTGCGGCTCGCCGCGCACGAGAAGCTGTCGCTCGTGTTCG
ACGAGGACGCGTGGGAGCTGAGCGGCACGGATGCCGCGGCGCTCGGCGAGCAGGCGGATGCGGCGGCGCG
CGAGGCAGCCGCTGCAGCGCAAGCGCGCGACGCGCACGAAGATGCGCATGGCACCCCCGAGTCGCATGAC
GCGCATGAAGCGATCGGCGGCGCGCGTGCCGATGCGGGCGACGAACCTCAGGCCGACGCGCATCGGTCCG
ACGAAACGACCTCGGCGAACGCCGGCACGACGGGAGAACCGTCATGCGTCTGA
 Primer design