SecReT6
Protein ID: 488606891
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3979
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]449468..451189 [-]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDN0ARY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-17, Aligned region: 69..129
ImpA-rel_N [PF06812], Evalue: 2.70E-17, Aligned region: 267..281
Protein Sequence: 573 a.a.     [Download]
>gi|488606891|ref|YP_007920440.1| impA-related N-terminal family protein [Burkholderia thailandensis MSMB121]
MGMSERPWPGGAAPVARPPVDVDALAALGRTDIDPAAPAGADVRADARFDALHAELAKLASPGASGHVDW
RSAMNLAAGLLRDRGKDLLVGCYLAGALLQIGGAAGLRCGLEVVGDLVERHWDAMSPPVARMRARRGALQ
WLLDRVDATRDAGAAACGRACPAELVGQLRAAARRIDALLAERDDDAPTMRAVNAFADRLPVEPVEPVES
NAMDAHVEVGETSASLAARSAGQASVEPADRTALRANADAARQPASLADAAGRERALADALAQLHRIAAA
FAQADWTDVRGVRLRRFACWSSVHTLPDTEADSGRTRIAAPNAQIVDVAKGIDVQGEPADAVRFAEEHAQ
AFPLWLDLQRIAARALARGDCADAQREVEAAVRALLARLPGLDALKFADGTPFADDATRAWLAGLSVQGG
ARNAAAPLSSSPSLPMTGDPDRAQGDAREAAADDAIDRASALAASGRIDLALQAIQQAIDRAPGAERRLR
ARIRLCELARDHWAHEIPDAFARGVIEPIRRHDLLAWDSELALDGLSVAYALLIRRDRDSAHARTVLDEI
AGVDAARAMRLSM
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c451189-449468 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGGAATGAGCGAACGGCCTTGGCCGGGCGGCGCGGCGCCGGTTGCGCGCCCGCCCGTGGATGTCGACG
CGCTTGCCGCGCTGGGGCGCACGGACATCGATCCAGCCGCGCCCGCGGGGGCCGACGTGCGCGCCGACGC
GCGGTTCGATGCGCTGCACGCGGAACTCGCGAAGCTCGCATCGCCGGGCGCGAGCGGGCACGTCGACTGG
CGCTCGGCGATGAATCTCGCCGCCGGGCTGCTGCGCGATCGAGGCAAGGATCTGCTCGTCGGCTGTTATC
TGGCGGGCGCGCTGCTGCAGATCGGCGGCGCGGCGGGGCTGCGCTGCGGGCTCGAAGTCGTCGGCGATCT
CGTCGAGCGTCATTGGGACGCGATGTCGCCGCCGGTGGCGCGGATGCGGGCGCGGCGCGGGGCGCTGCAA
TGGCTGCTCGATCGCGTCGACGCGACGCGGGACGCCGGCGCGGCCGCATGCGGCCGCGCTTGTCCGGCCG
AACTGGTCGGGCAATTGCGCGCGGCCGCGCGGCGGATCGATGCGCTGCTGGCGGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGAATGCGTTCGCGGACCGGCTGCCGGTCGAGCCAGTCGAGCCAGTCGAGTCG
AACGCGATGGATGCGCACGTCGAGGTGGGCGAGACTTCCGCGAGCCTCGCGGCCCGCTCCGCCGGGCAGG
CATCAGTCGAGCCGGCCGATCGCACGGCGCTGCGCGCGAACGCCGACGCCGCCCGGCAACCGGCGTCGCT
CGCCGATGCGGCCGGCCGCGAGCGCGCGCTCGCCGATGCGCTCGCGCAACTGCATCGCATCGCAGCGGCG
TTCGCGCAAGCGGACTGGACGGACGTGCGCGGCGTCCGGCTGCGCCGCTTCGCGTGCTGGTCGAGCGTGC
ACACGCTGCCGGACACGGAAGCGGACAGCGGACGGACGCGGATCGCCGCGCCGAATGCGCAGATCGTCGA
CGTGGCGAAAGGCATCGACGTGCAAGGCGAGCCCGCGGATGCCGTCCGCTTCGCCGAAGAGCACGCGCAG
GCGTTCCCGCTCTGGCTGGATCTACAGCGGATCGCCGCGCGCGCGCTCGCGCGCGGCGACTGCGCCGACG
CGCAACGCGAGGTGGAGGCGGCGGTTCGTGCGCTGCTCGCGCGGCTGCCGGGCCTCGATGCGCTGAAATT
CGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCGTGGCTCGCCGGGCTTTCCGTGCAGGGCGGC
GCGCGGAATGCGGCGGCGCCGCTTTCGTCTTCGCCGTCCTTGCCGATGACGGGCGACCCGGATCGTGCGC
AGGGCGATGCGCGCGAAGCGGCCGCCGACGACGCCATCGATCGTGCGAGCGCGCTCGCCGCAAGCGGTCG
GATCGATCTCGCGCTACAAGCGATTCAGCAAGCGATCGATCGCGCGCCGGGCGCCGAACGCCGGTTGAGG
GCGCGCATCCGGTTGTGCGAGCTCGCGCGCGATCATTGGGCACATGAGATTCCCGACGCGTTCGCGCGCG
GCGTGATCGAGCCGATCCGCCGGCACGACTTGCTCGCATGGGACTCCGAACTGGCGCTCGACGGCTTGTC
GGTCGCGTATGCGCTGCTGATTCGGCGCGATCGAGATTCGGCGCATGCGCGGACGGTGCTCGACGAGATC
GCGGGCGTCGACGCGGCGCGGGCGATGCGTTTGTCGATGTGA
 Primer design