SecReT6
Protein ID: 488606892
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4916
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1643159..1643740 [+]
Producthypothetical protein
NoteTssB
UniProt IDN0AM72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-58, Aligned region: 15..166
Protein Sequence: 193 a.a.     [Download]
>gi|488606892|ref|YP_007921363.1| hypothetical protein BTI_4916 [Burkholderia thailandensis MSMB121]
MTSKYKALASGQKFIARNRAPRVQIEYDVETYGAERRVQLPFVMGVIADLAGKRAEPLPELPERKFLEVD
VDNFDERMKSIAPRVAFHVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLEARTELSNLLSYM
DGKHGAEQLIENAINDPELLKSLVRQPLAASADGGAPAIAGTGAADDSEIRHE
 
Nucleotide Sequence: 582 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1643159-1643740 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACGAGCAAGTACAAGGCTTTGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTGGAGACTTACGGCGCCGAGCGCCGCGTCCAGTTGCCGTTCGTGATGGGCGTGAT
CGCCGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGAGCTGCCGGAGCGCAAGTTCCTCGAAGTCGAC
GTCGACAACTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCACGTGCCGAACACGCTGT
CGGGCGACGGGATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGACTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGATGCGCTCAGGCGCCTGCTGGAGGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGAACTGCTGAAGTCGCTCG
TGCGGCAGCCGCTCGCGGCGAGCGCCGACGGCGGCGCGCCGGCCATCGCCGGCACCGGCGCCGCGGACGA
TTCGGAGATTCGCCATGAATGA
 Primer design