SecReT6
Protein ID: 488606914
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4909
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1631925..1632443 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDN0AID5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-38, Aligned region: 14..157
Protein Sequence: 172 a.a.     [Download]
>gi|488606914|ref|YP_007921356.1| type VI secretion lipofamily protein [Burkholderia thailandensis MSMB121]
MRLRFSGSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDINRKPSPIVLKVFQLKTASAFESADF
FSLQDKPESVLGADLLSVDRIILRPGDARTLHYRGNVDASAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLSVAVKNGGVGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1631925-1632443 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCGACTGCGGTTCAGTGGTTCCGTCGTTCTGGGGTGCGCGTTGCTGCTTGCCGGATGCGGGGCGACGG
AGCGTTCCGTTGCCGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACATCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGTTGAAGACGGCGTCCGCGTTCGAGAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGGAGAGCGTGCTCGGCGCGGATCTGCTCAGCGTCGACCGGATCATCCTGC
GCCCGGGAGACGCGCGCACGCTGCACTACCGCGGCAACGTCGACGCGAGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAAAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGTCGGTCGCCGTGAAGAACGGCGGCGTCGGCC
TCGGCGGCGATTCGCGAGTACGTCAATGA
 Primer design