SecReT6
Protein ID: 488606974
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5353
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2178876..2181167 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDN0AII6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-71, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 1.30E-71, Aligned region: 584..610
Phage_base_V [PF04717], Evalue: 3.20E-22, Aligned region: 366..459
Protein Sequence: 763 a.a.     [Download]
>gi|488606974|ref|YP_007921793.1| Rhs element Vgr family protein [Burkholderia thailandensis MSMB121]
MRLIELRSSLLEPDAVALSFVVHESLSQEPTYQLDLLSRDPDLDFDALLGSTLSADIDLGGGDVRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNVSVPQIVEQVFQGHQRNGYRFELEGAYEPREY
CVQFQETDLNFVKRLLEDEGIYFRVEHEQDRHVVVISDTQRFEDLPLPNDELEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDARQESPPNLEGIPLEYYDYATGYRDPEQGERLARLRLEA
LQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLVTRRPRVSGLQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGFPNASQLTFDD
QRGAERVMVHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARF
TGLSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVATSMTGSSNSVTGVSNSM
TGISSSWKDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSTST
TGSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2178876-2181167 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCGTCTGATCGAATTGCGTAGTTCCCTGCTGGAGCCGGACGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCCTGTCGCAGGAGCCGACGTATCAGCTCGACCTGCTGAGCCGCGACCCGGATCTGGATTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCGGACATCGATCTGGGCGGAGGCGATGTGCGCACGTTCAACACGCAC
GTGTTCGGCGGTTACGACACGGGGCAGATGAGCGGGCAGTACACGTACACGCTGGAGCTGAGGAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACGTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTTCAGGGGCACCAGCGCAACGGTTATCGGTTCGAGCTGGAAGGCGCGTACGAGCCACGCGAGTAC
TGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGGTTGCTGGAGGACGAAGGGATCTATTTCC
GGGTCGAGCACGAGCAGGACCGTCACGTCGTCGTGATCTCGGATACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGATGAGCTCGAATACTTGCCAGACGGCGAGGAATCGCGAGCGATCCAGGGGCGCGAAGGCGTG
CAGCGGTTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTTGCGCTGCGCGACTTCGACTATCACGCGC
CGTCGAACAAGCTCGATAGCGATGCGCGGCAGGAGTCGCCGCCGAATCTCGAGGGGATTCCGCTCGAATA
CTACGACTACGCCACGGGCTATCGGGACCCGGAGCAGGGCGAGCGTCTCGCGCGCCTGCGGCTCGAAGCG
CTTCAGGCGGAATCGCACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCGACGGGCCGGGCGTTCA
CACTGATCGGGCATCCGGCGCTGGGCCGCAATCGGCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
TCAGGACGGACCGGATAGTACGTCGCAGGGGCGCAACGTCGCGGTCAAGTTCCGCGCGCTCGCCGACGAT
CAGCCGTTCCGGCCGCTGCTCGTCACCAGGCGGCCGCGCGTGTCGGGTCTCCAGAGCGCGACGGTGGTGG
GGCCGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGCATCCGCGTGCACTTCCATTGGGACCGCTA
CAAGACGACCGAGGCCGATGCGTCGTGCTGGATTCGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGATCGTCGTGTATGTCGACGGCGATCTCGATCGGCCGC
TCGCGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCATACGACTTGCCGAAGGACATCCGCTACAC
GGGCCTCGTCACGCGCTCGATCAAGCGCGCGGGCGGTTTTCCGAACGCTAGCCAACTGACGTTCGACGAC
CAGCGCGGCGCGGAGCGCGTGATGGTCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGATCGCGCAGGACCTGAACCTGTCGGTGAAGGGGACGTCGACATCGGTCGTCGGGATCTCGGT
CAGCTTCACCGGGATCTCGGTGTCGTACACGGGGCTGTCGGTGAGCTTCACCGGCGTATCGGCGAGGTTC
ACCGGCCTGAGCACGTCGTTTACTGGCGTGAGCACGAGCTTCACCGGCGTGTCGACTTCGTTCACTGGCG
TCGATACGAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGTTTCACCGGCGTCGCCAC
GTCGATGGTCGGCGTCGCGACGAGCATGACGGGCTCCAGCAATTCGGTGACGGGCGTGTCGAACAGCATG
ACGGGCATCTCGTCGTCGTGGAAGGACGTCAGCATGTCGACGACCGGCCAGTCGCAGAGCATCACCGGCG
TGTCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGAC
GAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACGTCGACGTCGACG
ACGGGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGCTCGGTGGGCACGACGGGTT
CGAGCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACAGGGGCGAGCTA
CGAGGACGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA
 Primer design