SecReT6
Protein ID: 488607015
SecReT6 ID759
T6SS typei1
Gene symbolclpV
Locus tagBTI_3988
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]459883..462729 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDN0ATE7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 226..242
AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 648..815
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 227..337
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 654..761
AAA_5 [PF07728], Evalue: 5.30E-14, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 5.30E-14, Aligned region: 329..355
AAA_5 [PF07728], Evalue: 5.30E-14, Aligned region: 653..770
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 820..890
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 411..440
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 651..747
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 36..113
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 343..485
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 469..572
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 624..689
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 718..747
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 815..853
AAA_16 [PF13191], Evalue: 3.40E-08, Aligned region: 854..900
Zeta_toxin [PF06414], Evalue: 4.80E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 4.80E-06, Aligned region: 652..694
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 40..76
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 116..137
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 435..464
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 651..685
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 854..905
IstB_IS21 [PF01695], Evalue: 5.30E-05, Aligned region: 219..265
IstB_IS21 [PF01695], Evalue: 5.30E-05, Aligned region: 653..689
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 28..75
Sigma54_activat [PF00158], Evalue: 0.0002, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.0002, Aligned region: 653..769
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 166..194
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 447..520
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 649..674
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 276..325
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 652..674
ResIII [PF04851], Evalue: 0.0011, Aligned region: 210..247
ResIII [PF04851], Evalue: 0.0011, Aligned region: 293..306
ResIII [PF04851], Evalue: 0.0011, Aligned region: 625..687
TIP49 [PF06068], Evalue: 0.0014, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.0014, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.0014, Aligned region: 652..688
NACHT [PF05729], Evalue: 0.0014, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0014, Aligned region: 653..674
AAA_17 [PF13207], Evalue: 0.0037, Aligned region: 227..245
AAA_17 [PF13207], Evalue: 0.0037, Aligned region: 466..523
AAA_17 [PF13207], Evalue: 0.0037, Aligned region: 653..689
AAA_17 [PF13207], Evalue: 0.0037, Aligned region: 826..854
AAA_18 [PF13238], Evalue: 0.0046, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0046, Aligned region: 654..695
AAA_11 [PF13086], Evalue: 0.0081, Aligned region: 226..437
AAA_11 [PF13086], Evalue: 0.0081, Aligned region: 651..698
Protein Sequence: 948 a.a.     [Download]
>gi|488607015|ref|YP_007920449.1| type VI secretion ATPase, ClpV1 family [Burkholderia thailandensis MSMB121]
MLLVDLKPLIEQLNPYCRTALENAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRASGADAARLRRQ
ADAALDARPAGGGARPAFAPSLLALLQDAWLIASLELGETHIRSAAVLAAAVARAARQPSPGGEDVLQSL
RKDALVARFASGACAQSIESRRPAARDAAPGDANDAHDASSAIARYCEDFTAKARAGRIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRHATLLGLDLGLLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFVDEAHTLIGAGGPAGASDAANLLKPALARGELRTIAATTWSEYKKHFEKDAA
LARRFQPVKLDSPDVSTSVMILRGLKDRYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRQELAERCAPDTPRVADIDREHAALSARADALRDAWAAQ
RDAAQALIDARRACRAAADAADAAEAADAVDVADVADIADVDASAGAAAAASRAHAEPASHADARERAAR
AHADATRRFEHAQRDARLVRIDVDPDAIADVVADWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIG
QIAQAVKTGAAGVRDPRRPLGVFLLAGPSGTGKTETALAVADALFGDERSIVVVNMSEFQERHDVSRLIG
SPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEKAHPDVLNLFYQVFDKGTLSDGEGKEVDFANTVIFLTS
NLGADAVADLAAHGARPDPDAMRAAIRPALSRHFKPALLARMTEIPYTTLAPDALADIARLKLERIAARV
AAQHATRVVYDDAVVAHVAARCTEVESGARNVDFILQRHVLPALAQHVLVCAADATQVAAIRVAVDAGGR
FAVSADGPAGGDARGASDEPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|488605303|ref|NC_021174.1|:459883-462729 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGACGGCGCTCGAAAACG
CCGTCGGCGCCTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAGCCGTCGGCCGACGTCGCGCTGCTGCTGCGCGCGAGCGGCGCCGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCGGCGCTCGATGCGCGGCCGGCGGGCGGCGGCGCACGCCCCGCCTTCGCGCCGTCGCTGCTCG
CGCTGCTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGAGACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCGCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGAGGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCATGCGCGCAATCGATCGAATCGCGCCGGCCCG
CCGCGCGCGACGCCGCGCCGGGCGATGCGAACGACGCGCACGATGCGTCGAGCGCGATCGCCCGCTATTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCCGGATCGACCCGGTGTTCGGCCGCGACGCGGAGATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTCGGCA
AGACGGCCGTCGTCGAGGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTACCGGCGACGCTGCGCCACGC
GACGCTGCTCGGCCTCGATCTCGGGCTGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAGACGCCCGTCGTGCTGTTCGTCGACGAGGCGCACA
CGCTGATCGGCGCGGGCGGCCCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCGGCTACCACGTGGAGCGAATACAAGAAGCACTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCTCGACGTCGGTGATGATCCTGCGCG
GCCTGAAGGACCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTCGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACAGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACGAAGCCCGCCGCGCTCGAGGACGCGCAGCGCGCGATCCAGGCGT
TGGAGCGCGAGCGGCGCGCGCTGCGGCAGGAACTGGCCGAGCGCTGCGCGCCGGACACGCCGCGCGTCGC
CGACATCGATCGCGAGCACGCCGCGCTGTCCGCGCGCGCCGACGCGTTGCGCGACGCATGGGCGGCGCAG
CGCGACGCGGCGCAGGCGCTCATCGACGCGCGCCGCGCGTGCCGGGCTGCCGCGGATGCCGCGGATGCCG
CTGAAGCGGCCGACGCCGTCGATGTCGCCGACGTTGCCGACATCGCCGATGTCGATGCGAGTGCCGGGGC
CGCCGCGGCCGCCTCTCGCGCGCATGCCGAGCCGGCCTCGCACGCCGACGCGCGCGAGCGCGCGGCGCGC
GCGCACGCCGACGCGACCCGCCGTTTCGAGCACGCGCAACGCGACGCGCGGCTCGTGCGAATCGACGTCG
ATCCGGACGCGATCGCCGACGTCGTGGCCGACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGACCG
CGCAAACGTGATGCTGCGGCTCGCCGATACGCTCAGGCGCCGCATCCGCGGCCAGGATCACGCGATCGGG
CAGATCGCGCAGGCCGTGAAGACGGGCGCGGCCGGCGTCCGCGATCCGCGCCGGCCGCTCGGCGTGTTCC
TGCTCGCGGGGCCGTCGGGGACCGGCAAGACCGAGACCGCGCTCGCCGTCGCCGACGCGCTGTTCGGCGA
CGAGCGCTCGATCGTCGTCGTCAACATGAGCGAATTCCAGGAGCGGCACGACGTGAGCCGGCTGATCGGC
TCGCCGCCCGGCTACGTCGGCTACGGCGAAGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATT
CGGTCGTGCTGCTCGACGAAGTCGAGAAGGCTCACCCGGACGTGCTGAACCTGTTCTATCAGGTGTTCGA
CAAGGGCACGCTGTCCGACGGCGAAGGCAAGGAAGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCG
AATCTCGGCGCGGATGCCGTCGCCGATCTCGCGGCGCACGGCGCCCGCCCCGATCCGGACGCGATGCGCG
CGGCGATCCGGCCCGCGCTGTCGCGCCATTTCAAGCCCGCGCTGCTCGCGCGGATGACCGAGATTCCATA
TACGACGCTCGCGCCCGACGCGCTCGCCGACATCGCGCGGCTGAAGCTCGAACGCATCGCGGCGCGCGTC
GCCGCGCAGCACGCGACGCGCGTGGTCTACGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCG
AAGTCGAATCGGGCGCGCGCAACGTCGACTTCATCCTGCAACGGCACGTGTTGCCCGCGCTCGCGCAGCA
CGTGCTCGTCTGCGCGGCGGACGCGACGCAGGTGGCCGCGATCCGCGTCGCGGTGGACGCCGGCGGCCGC
TTCGCCGTGTCGGCCGACGGGCCGGCCGGGGGCGATGCGCGGGGTGCATCCGATGAGCCCAACGCGCCCA
ACGCGCCCAACGCGCCCAACGCGCCCAACGCGCCCAACGCGCGCTGA
 Primer design