SecReT6
Protein ID: 488607023
SecReT6 ID761
T6SS typei3
Gene symbolclpV
Locus tagBTI_4922
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1649487..1652144 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDN0AKM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 226..245
AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 613..779
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 227..329
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 618..702
ClpB_D2-small [PF10431], Evalue: 5.50E-13, Aligned region: 210..221
ClpB_D2-small [PF10431], Evalue: 5.50E-13, Aligned region: 373..398
ClpB_D2-small [PF10431], Evalue: 5.50E-13, Aligned region: 785..859
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 227..246
AAA_5 [PF07728], Evalue: 6.70E-12, Aligned region: 617..738
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 124..153
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 204..243
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 370..393
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 504..535
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 610..661
AAA_16 [PF13191], Evalue: 2.80E-10, Aligned region: 682..700
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 227..307
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 367..395
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 614..647
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 222..242
Sigma54_activat [PF00158], Evalue: 6.20E-07, Aligned region: 599..730
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 220..248
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 615..640
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 727..749
AAA_25 [PF13481], Evalue: 8.40E-06, Aligned region: 225..251
AAA_25 [PF13481], Evalue: 8.40E-06, Aligned region: 360..391
AAA_25 [PF13481], Evalue: 8.40E-06, Aligned region: 592..640
AAA_25 [PF13481], Evalue: 8.40E-06, Aligned region: 784..823
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 224..248
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 374..403
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 611..639
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 228..244
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 373..400
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 616..653
Zeta_toxin [PF06414], Evalue: 6.00E-05, Aligned region: 227..244
Zeta_toxin [PF06414], Evalue: 6.00E-05, Aligned region: 616..657
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 284..307
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 615..734
RuvB_N [PF05496], Evalue: 0.00022, Aligned region: 226..242
RuvB_N [PF05496], Evalue: 0.00022, Aligned region: 297..307
RuvB_N [PF05496], Evalue: 0.00022, Aligned region: 578..638
RuvB_N [PF05496], Evalue: 0.00022, Aligned region: 686..770
AAA_29 [PF13555], Evalue: 0.00072, Aligned region: 217..240
AAA_29 [PF13555], Evalue: 0.00072, Aligned region: 612..642
AAA_18 [PF13238], Evalue: 0.00085, Aligned region: 228..246
AAA_18 [PF13238], Evalue: 0.00085, Aligned region: 618..646
Arch_ATPase [PF01637], Evalue: 0.0025, Aligned region: 124..154
Arch_ATPase [PF01637], Evalue: 0.0025, Aligned region: 205..240
Arch_ATPase [PF01637], Evalue: 0.0025, Aligned region: 283..311
Arch_ATPase [PF01637], Evalue: 0.0025, Aligned region: 615..638
NACHT [PF05729], Evalue: 0.003, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.003, Aligned region: 286..334
NACHT [PF05729], Evalue: 0.003, Aligned region: 617..645
ResIII [PF04851], Evalue: 0.0033, Aligned region: 218..246
ResIII [PF04851], Evalue: 0.0033, Aligned region: 284..309
ResIII [PF04851], Evalue: 0.0033, Aligned region: 589..639
Hpr_kinase_C [PF07475], Evalue: 0.0058, Aligned region: 227..240
Hpr_kinase_C [PF07475], Evalue: 0.0058, Aligned region: 618..635
Protein Sequence: 885 a.a.     [Download]
>gi|488607023|ref|YP_007921369.1| type VI secretion ATPase, ClpV1 family [Burkholderia thailandensis MSMB121]
MSDIGRVTLFGKLNAFLYETLEQATGFCRLRGNPYVELVHWLNPMLQRPDSDVHRILRRFDIDTAAVDRG
IVSALERLPRGAGSVSDLSVHIDDAVERAWVYATLKYDATQIRSAVLLLAILKTTQLRNVLYAIARDFER
IVPDVLADELEQIVEGSPEAPPPAARASAGAAGGASSAAREGSALARYAVDLTARARAGEIDPVVGRDGE
IRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKGEFE
SRLRGVIDEASSSERPVILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYIEKD
PALTRRFQLVQVREPEEDAALTMLRGLAAKLEAHHRVLVLDDALRAAVMLSHRYIPARQLPDKAISLLDT
ACARVAVSQHAVPAPIEDARRRIDSLRVERELVARECALGAGDAPRLGAIDASIASEQAALDALDARWQA
ERDALGKIVDWRTSLLADDPSRALDATDRADAQAKLSTALSELADLQGETPLVLPAVDTHAVAAVVSDWT
GIPLGRMVRDEMQSVLKLADTLAERVVGQRHAVELIAQRIQTARARLDDPAKPHGVFLLCGPSGVGKTET
ALALAETLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHR
DVHEIFFQVFDKGWMEDGEGRYIDFRNTVIILTSNVGSERVMQLCRDPQRPPDAQTLTDALRAPLRDVFP
AALLGRLTVVPYYPLTDEMLARIVALQLDRIERRIEAHHGIALRCADSATALIVERCRTIESGGRMVDAI
LTHTVLPRISQEILRATIEGRALRAIDVSADDGQFVYRFEEEGAT
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1649487-1652144 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGTCCGATATCGGCCGAGTGACCTTGTTCGGAAAACTGAACGCTTTTCTCTACGAGACGCTGGAGCAGG
CGACGGGCTTTTGCCGGCTGCGCGGCAATCCATACGTCGAGCTCGTGCACTGGCTGAATCCGATGCTCCA
GCGCCCGGACAGCGACGTGCACCGCATCCTGCGCCGCTTCGACATCGACACGGCGGCGGTGGATCGCGGG
ATCGTGTCGGCGCTCGAGCGGCTGCCGCGCGGCGCCGGCTCGGTGTCCGATCTGTCCGTGCACATCGACG
ATGCGGTCGAGCGCGCATGGGTGTACGCAACGCTCAAGTACGACGCGACGCAAATCCGAAGCGCGGTGCT
GCTGCTCGCGATCTTGAAGACGACGCAACTGCGCAACGTGCTGTATGCGATCGCGCGCGACTTCGAGCGG
ATCGTGCCGGACGTGCTCGCCGACGAGCTCGAGCAGATCGTCGAAGGCTCGCCGGAAGCGCCGCCGCCGG
CGGCGCGCGCATCGGCGGGCGCGGCGGGCGGCGCATCGTCCGCCGCGCGCGAAGGCTCGGCGCTCGCGCG
CTACGCGGTGGACCTGACCGCGCGGGCGCGCGCGGGCGAGATCGATCCGGTGGTCGGCCGCGACGGCGAG
ATTCGCCAGATCGTCGACATCCTGCTGCGGCGCCGGCAGAACAATCCGCTGCTCGTCGGCGAAGCGGGCG
TCGGCAAGACCGCGGTGGCCGAAGGCTTCGCGCTGCGCATCGTCGCGGGCGACGTGCCGCCGCCGCTGCG
CGACGTCGAGCTGTATCTGCTCGACATCGGCTTGCTGCAGGCGGGCGCGAGCGTGAAAGGCGAATTCGAG
AGCCGCCTGCGCGGCGTGATCGACGAGGCGAGCTCGAGCGAGCGGCCCGTCATTCTGTTCATCGACGAAG
TGCACACGCTCGTCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCGAACCTGCTGAAGCCGGCGCT
CGCGCGCGGCTTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAGTACAAGCAATACATCGAGAAGGAC
CCGGCGCTCACGCGGCGCTTCCAGCTCGTGCAGGTGCGCGAGCCAGAGGAGGACGCGGCGCTGACGATGC
TGCGCGGGCTCGCCGCGAAACTCGAAGCGCACCACCGCGTGCTGGTGCTCGACGATGCGCTGCGGGCGGC
CGTCATGCTGTCGCATCGCTATATTCCCGCGCGGCAGTTGCCCGACAAGGCGATCAGCCTGCTCGACACC
GCGTGCGCGCGCGTCGCGGTGAGCCAGCATGCGGTGCCCGCGCCGATCGAGGATGCGCGGCGCCGGATCG
ACAGCCTGCGCGTCGAGCGCGAGCTCGTCGCGCGCGAGTGCGCGCTCGGCGCGGGCGATGCGCCGCGGCT
CGGTGCGATCGACGCATCGATCGCGAGCGAACAGGCGGCGCTCGATGCGCTCGATGCGCGCTGGCAGGCC
GAGCGCGATGCGCTCGGCAAGATTGTCGACTGGAGGACTTCGCTGCTCGCGGACGATCCGTCGCGCGCGC
TCGATGCAACGGATCGCGCGGATGCGCAGGCAAAGCTTTCGACTGCATTGAGCGAGCTCGCCGATTTGCA
AGGCGAGACGCCGCTCGTGCTGCCCGCGGTCGACACGCACGCGGTGGCGGCCGTCGTGTCCGACTGGACC
GGCATTCCGCTCGGCCGGATGGTGCGCGACGAGATGCAATCGGTGCTGAAGCTGGCCGATACGCTCGCCG
AGCGCGTCGTCGGCCAGCGGCATGCGGTCGAGCTGATCGCGCAACGCATTCAGACCGCGCGCGCGCGGCT
CGACGATCCGGCGAAGCCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAGACCGAGACC
GCGCTCGCGCTCGCCGAGACGCTGTACGGCGGCGAGCACAACGCGATCACGATCAACATGAGCGAGTTTC
AGGAGGCGCATACGGTGTCGACGCTGAAGGGCGCGCCGCCCGGCTACGTCGGCTACGGACAGGGCGGCGT
GCTGACCGAGGCGGTGCGGCGGCGGCCATACAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCGCATCGC
GACGTGCACGAGATCTTCTTTCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAAGGGCGCTACATCG
ACTTTCGCAACACGGTGATCATCCTCACGTCGAACGTCGGCTCCGAGCGCGTGATGCAGTTGTGCCGCGA
TCCGCAGCGCCCGCCCGATGCGCAGACGCTGACCGACGCGCTGCGCGCGCCGCTGCGCGACGTGTTCCCC
GCCGCATTGTTGGGACGCCTGACGGTCGTCCCGTACTACCCGCTCACCGACGAGATGCTCGCGCGGATCG
TCGCATTGCAGCTCGACCGCATCGAGCGCCGCATCGAAGCGCATCACGGCATCGCGCTGCGCTGCGCGGA
TTCGGCGACCGCGCTGATCGTCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGGATGGTCGACGCGATT
CTCACGCACACGGTGCTGCCGCGCATCAGTCAGGAGATCCTGCGCGCGACGATCGAGGGGCGCGCGCTGC
GGGCGATCGACGTGAGCGCCGACGACGGCCAGTTTGTTTATCGATTCGAAGAGGAGGGCGCGACGTGA
 Primer design