SecReT6
Protein ID: 488607039
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3985
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]456636..457106 [+]
Productlysozyme family protein
NoteTssE
UniProt IDN0AIQ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-18, Aligned region: 40..133
Protein Sequence: 156 a.a.     [Download]
>gi|488607039|ref|YP_007920446.1| lysozyme family protein [Burkholderia thailandensis MSMB121]
MAHTEEVSARPPARRPTGGRRLLERIADWEAGGEHARLPRADALTRSIIDHLRRILNTRQGHVPIDPAFG
VPDFTNLAGGFAQGSAREIEAQIERVIACYEPRLKSPRIALAERAPGATTLHFSLDAQLVIDAREVPARF
LTTVGGNGKIDIRTIS
 
Nucleotide Sequence: 471 bp     [Download]
>gi|488605303|ref|NC_021174.1|:456636-457106 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGCTCACACCGAAGAAGTGAGCGCGCGCCCGCCGGCGCGCCGGCCGACGGGCGGGCGTCGCCTGCTCG
AACGCATCGCGGACTGGGAGGCGGGCGGCGAGCATGCTCGCCTGCCTCGCGCCGACGCGCTCACGCGCTC
GATCATCGATCACCTGCGCCGCATCCTGAACACGCGGCAAGGCCACGTGCCGATCGATCCGGCCTTCGGC
GTGCCGGACTTCACGAATCTCGCGGGCGGCTTCGCACAAGGGTCCGCCCGCGAGATCGAGGCGCAGATCG
AGCGCGTGATCGCGTGCTACGAGCCGCGGCTGAAATCGCCGCGCATCGCGCTCGCCGAGCGCGCGCCCGG
CGCGACGACGCTGCACTTCAGTCTCGACGCGCAGCTCGTGATCGACGCGCGCGAAGTGCCGGCGCGCTTT
CTGACGACCGTCGGCGGCAACGGAAAGATCGATATCCGAACCATTTCCTGA
 Primer design