SecReT6
Protein ID: 488607077
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5349
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2170779..2172638 [+]
Producthypothetical protein
NoteTssF
UniProt IDN0AMM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-128, Aligned region: 3..604
Protein Sequence: 619 a.a.     [Download]
>gi|488607077|ref|YP_007921789.1| hypothetical protein BTI_5349 [Burkholderia thailandensis MSMB121]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYMASTPAISTFAFHPDLGSPDAFRGNTLPRGSLVAAHLPGRKLPVMFSTARDVTLLPLRI
ASVECSRSITGLPALLAQRLASSHAVLRFRFEVEGGASIAELSREDDGFKPLHLSLAGDLPRAYALHRAM
LADTTAWYALVSTNRGDEVLTLPMSGIRLSGVDDAEALLPEEFGGLPGLRLLREYFAQPTRLLGVYVDAL
AEIAAKAPSARAFELFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLAPDDVATITGRALVADRDWRPSGLLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRAPQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVLLRSRFVAAGRATPTALVRATQVE
IDIAESLHADRGGWLFGRLLAHALAEAATLNDGIEIVVRLDGEAASTHTNVASRDGRLA
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2170779-2172638 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAATTTCCTCGATCACTACAACGACGAATTGCGCCAACTGCGCGATGCGGGCGCGCGCTTCTCCAAGG
AGCACCCGCAGGTTGCGTCGGCGCTCGGGCTGCATCCCGATGCGGTTACTGATCCGTTCGTCGAGCGGCT
GCTCGAGGGCGTCGCGTATCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGTCCGCTCTATATGGCGTCGACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCGGATCTCGGCTCGCCTGACGCGTTTCGCGGCAACACGCTGCCGCGCGGCTCGCTCGTTGCCGCGCA
CCTGCCGGGCCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGACGTCACGCTGCTGCCGCTGCGCATC
GCGTCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGGCGCTGCTCGCGCAGCGGCTTGCGTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGGTCGAGGGCGGCGCGTCGATCGCGGAGCTCTCACGCGAGGATGA
CGGATTCAAGCCGCTGCACCTGAGCCTCGCGGGCGATCTGCCGCGCGCGTATGCGCTGCATCGCGCGATG
CTCGCCGACACGACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGCGACGAGGTGTTGACGCTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTTGACGACGCGGAGGCGCTGCTGCCGGAGGAGTTCGGCGGGTTGCC
CGGCCTGCGGCTGTTGCGCGAGTACTTCGCGCAGCCGACGCGTCTGCTCGGCGTCTACGTCGACGCACTG
GCGGAGATCGCCGCGAAGGCGCCGTCCGCGCGCGCGTTCGAGCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTCGGCGACGTCGACGCAAGCCAGTTTCGCCTGTTCGCTACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGATCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTGACCGAGGTGTTCGTGTGCGAGACCAACGGCCGCGCGCATCGCG
CGCGCTCAGTGCTCGAGACGGCGGGCTACGAAGGGCATGAAGGCTCGATCCGCTACGGCATGCGGCGCGA
GGACGCGCTGCTTGTCGACGGCGTGCGGCGTGATCGGTTCGATCCGCTCGCAAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGCCCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGTCCGAGCGGGCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACGGCGGTGAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCCGTG
TCGCACGTCGGCCGCAATCCGCTCGCGCTGCGCGCACCGCAGCAGGACGTGACGGCGCGCATCGTCGAGC
AGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGACCGTCAGCGGCTCGAGAGCCTGCGCTCGGTCCT
GCTGCGCTCGCGCTTCGTCGCGGCGGGCCGCGCGACGCCGACCGCGCTCGTGCGCGCGACGCAGGTCGAG
ATCGACATCGCCGAATCGCTGCACGCGGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCACGCGC
TCGCCGAGGCCGCGACGCTCAACGACGGCATCGAGATCGTCGTGCGGCTCGACGGCGAAGCGGCGAGCAC
GCACACGAACGTCGCGTCGCGCGACGGGAGGCTCGCATGA
 Primer design