SecReT6
Protein ID: 488607087
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4920
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1646377..1648248 [+]
Producthypothetical protein
NoteTssF
UniProt IDN0AMN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.80E-217, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|488607087|ref|YP_007921367.1| hypothetical protein BTI_4920 [Burkholderia thailandensis MSMB121]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPIPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAASEQTACEFRTAHDLTLWP
LELAAATVTGAPAYLPRSATASRRDVRGALRIRLKARGGASLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHVLGADALAHQGFDADQALLPDDGRSFQGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHIALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLASEPRDDGQARVFRPFHASFAGDDGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSDCAPHDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAAIRGPSRPRPPIADAQTAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFTPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPTRVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1646377-1648248 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGACACGCGTCTGCTCGATTACTACAACCGCGAGCTCGCATACCTGCGCGAGCTCGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCATACGTCGA
GCGGCTGCTCGAAGGCTTCAGCTTCCTCACCGCGCGCGTGCAGCTCAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGCTACGTCGCGCCGATTCCGTCGATGGCGATCGTTC
AGTTCACGCCGATGATGAACGAGGGCAGCCTCGCGCAAGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCGGCCGCGTCCGAGCAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACACTGTGGCCG
CTGGAACTCGCGGCCGCCACGGTCACGGGCGCGCCCGCGTATCTGCCGCGCTCGGCGACAGCCTCGCGGC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCACGCGGCGGCGCGAGTCTCGCGCAACTGCCGAT
CGACCGGCTGATGTTCCATCTCGCCGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGA
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGTGCTCGGCGCGGATG
CGCTCGCCCATCAGGGCTTCGACGCGGACCAGGCGCTGCTGCCCGACGACGGCCGCAGCTTCCAGGGCTA
CCGCCTGCTGCGCGAGTATTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGGTTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCATGATGCTGCGCTCG
AAAACAGCGTCGACGCGCGGCACATCGCGTTGAACTGCACGCCGGCCGTCAATCTGTTCGCACGTCGCGC
GGACCGCATTCCGGTTCATCCGGGCGCGCGCGAGCACCATGTGGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGTCGGCTCGCGAGCGAGCCGCGCGACGACGGTCAGGCACGCGTGTTCCGGC
CGTTCCACGCGTCGTTCGCGGGCGACGACGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGATTGCGCGCCGCACGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ATCGCGACCTCGTGCTGCTGTTGCCGGCGGGCGATGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCGCGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGATCGCCGATGCGCAGACCGCATGG
CGGCTCGTGAGCCACCTCGGGCTCGCGCGCCACACGCTGACCGACGTCGACGACGAAGAAGGCGCGCGTG
TGCTGCGCGAGCTGCTCGGCCTGCATGCGGACCCGGCCGACGCGGCGATGCGCCGGCAGATCGACGGCGT
GCACCGCGTCGCGTTCACGCCGGTGTTCCGCCGGCTGCCGGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCACGCGTTTTCCGGCGACAGCCCGTATCTGCTCGGCGCGGTGC
TCGAGCAGTTCTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAGTGGCCGACGCGCGTCGGCAGGCGGCCCGCGATATGA
 Primer design