SecReT6
Protein ID: 488607150
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3982
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]453979..454473 [+]
Producthypothetical protein
NoteTssB
UniProt IDN0ATR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.50E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|488607150|ref|YP_007920443.1| hypothetical protein BTI_3982 [Burkholderia thailandensis MSMB121]
MTTNGSVAPKERVNIVYRPATGDAKAEVELPLKVLVLGEFSTADDKPPLEELAPVNVDKDDFNDVMKAQR
LRLALSVPNLLDDQAGEDERLAVALGFESIDDFSPDAIVETVPELKQLVALRDALKALKGPLGNIPGFRR
RIQEIVADKGARKQLLTELGLDDQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|488605303|ref|NC_021174.1|:453979-454473 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACAACGAACGGATCCGTCGCGCCGAAAGAGCGGGTCAACATCGTCTATCGCCCGGCCACGGGCGACG
CGAAAGCGGAAGTCGAGCTGCCGCTCAAGGTACTCGTGCTCGGCGAATTCTCGACGGCCGACGACAAGCC
GCCGCTCGAGGAGCTCGCGCCCGTGAACGTCGACAAGGACGACTTCAACGATGTGATGAAGGCGCAGCGC
CTTCGGCTCGCGCTGAGCGTGCCGAACCTGCTCGACGATCAGGCGGGCGAAGACGAACGCCTGGCCGTCG
CGCTCGGCTTCGAATCGATCGACGATTTCTCGCCCGACGCGATCGTCGAGACGGTGCCCGAACTGAAGCA
GCTCGTCGCGCTGCGCGACGCGCTGAAGGCGCTGAAGGGCCCGCTCGGCAACATCCCGGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAACTGCTCACCGAACTCGGCCTCGACGACC
AATGA
 Primer design