SecReT6
Protein ID: 488607213
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4918
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1645302..1645793 [+]
Producthypothetical protein
NoteTssD
UniProt IDN0AL83
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|488607213|ref|YP_007921365.1| hypothetical protein BTI_4918 [Burkholderia thailandensis MSMB121]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCANGKHLSSVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLLMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1645302-1645793 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGATGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCGTGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTGGCCGCGTACATGGACAAGGGCGCCACGGCGATCATC
AAGAACTGCGCGAACGGCAAACATTTGTCGTCCGTCGAGATCTCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTCGATCCGGG
CGACGCCGCCGACCGGCTGCTGATGCAGTACGGCTTCCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAGGTGTCGGTAGGCTGGAACATCAAGGAAAACACCGAGATGT
GA
 Primer design