SecReT6
Protein ID: 488607230
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3989
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]462756..465740 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDN0ATZ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-66, Aligned region: 40..344
Phage_base_V [PF04717], Evalue: 1.00E-15, Aligned region: 390..483
Protein Sequence: 994 a.a.     [Download]
>gi|488607230|ref|YP_007920450.1| Rhs element Vgr family protein [Burkholderia thailandensis MSMB121]
MLPSHRHDAAAPPANARRFTFASEAYDDAAFEVVDLTGRDAISQPYRFELTLVSEQPRIDFAKMLSRAAT
LTILPPYGDAGTTRYAGVLAEFEQLNGFRNLTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIVKQVLRG
ASFGSRDYRLRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGKRETLAIVDDRRHQPGPADD
LALRYLPAADFDTGIESNRVQAFACRATPLPREVVLRDFNHRKAELPLEVRERVSRDGIGERVSSDEHFH
SKDEGRRYAKLRAEALVCEGRRFSGEATAAGLRAGRFVALAGHYRADFDGRYLVTAVTHRGSQAGLLFPD
LDTPFGATPGAPVYRAEFDAIAADVQYRPPRATPKPRAAGVISAIVDGEGGGKLAELDEYGQYKVRFPFA
HTAHPANQGSARIRMATPYAGADRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVTRRNPAA
HRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGGGLALLTSGNKFDFSLGNAYSFSGGLKCSVSMG
GNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRTFEINDSASTLLQTLHKQSATGAIRLSAGQDASAL
LQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGAVADLPWAGFGISAAQFAGASAVSTALMATAR
TLLANVAKLQEALPLVADLSLGKHGIALAAKNLTHATRMSLAVDGLTWSTHAKGPGAAGVAMSAGKGRWG
VESAKHAHVHASDTLLFAVPADPATRLDLKDLIGLRRDLDACVKDIADLEADISENEVLSTRQNAFGVSA
LVPTPPSPADAVAAVAIKAKEAKLAGLNAKHRLVALKIDNLQQKLEKHVNNLSAVRMSASDAQLGFKGHR
LVATADGVTLAHAQGKAKLDVREAKIGVVAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVRATNVKLNG
SASLKFDGQLIQLG
 
Nucleotide Sequence: 2985 bp     [Download]
>gi|488605303|ref|NC_021174.1|:462756-465740 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGTTGCCATCCCACCGACACGATGCCGCCGCGCCGCCCGCGAACGCGCGGCGCTTCACGTTCGCGAGCG
AAGCGTACGACGACGCTGCGTTCGAGGTCGTCGACCTGACCGGCCGCGACGCGATCTCGCAGCCGTACCG
GTTCGAGCTGACGCTCGTGAGCGAGCAGCCGCGAATCGACTTCGCGAAGATGCTGAGCCGCGCGGCCACG
CTCACGATCCTGCCGCCGTACGGCGACGCCGGCACGACCCGCTATGCCGGCGTGCTCGCCGAATTCGAGC
AGTTGAACGGCTTTCGCAACCTCACCGTCTATCGCGCGACGCTCGTGCCGCGCCTCTGGCGGCTGTCGCT
GTACAAGGCATCCGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTGAAGCAGGTGCTGCGCGGC
GCGTCGTTCGGCAGCCGCGACTACCGCCTGCGGCACGGCGGCGGCTATCGCAAGCGCAGCTTCGTCTGCC
AGTACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAAAAGGAAGGCCTCTACTACTACTTCGA
GCACGACGGCAAGCGCGAGACGCTCGCGATCGTCGACGACCGCCGCCATCAGCCGGGCCCCGCCGACGAT
CTCGCGCTGCGCTACCTGCCCGCGGCCGACTTCGACACGGGCATCGAATCGAACCGCGTGCAGGCGTTCG
CGTGCCGCGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGATTTCAATCACCGCAAGGCGGAACTGCC
GCTCGAAGTGCGCGAGCGCGTGTCGCGCGACGGCATCGGCGAGCGGGTGTCGAGCGACGAGCATTTCCAC
TCGAAGGACGAAGGCCGGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCTGCGAAGGCCGCCGGTTCT
CGGGCGAGGCGACCGCGGCCGGCCTGCGCGCCGGCCGCTTCGTCGCGCTCGCCGGCCACTATCGCGCGGA
TTTCGACGGCCGCTATCTGGTGACGGCGGTCACGCATCGCGGCTCGCAGGCGGGCCTGCTGTTTCCCGAT
CTCGACACGCCGTTCGGCGCGACGCCGGGCGCGCCCGTCTATCGCGCCGAGTTCGACGCGATTGCCGCCG
ACGTCCAGTACCGGCCGCCGCGCGCGACGCCGAAGCCGCGCGCGGCGGGCGTCATCAGCGCGATCGTCGA
CGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGGCAGTACAAGGTGCGCTTTCCGTTCGCG
CACACCGCGCATCCCGCGAACCAGGGCTCCGCGCGAATCCGGATGGCCACGCCCTATGCGGGCGCCGACC
GCGGCATGCACCTTCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCCTTCGACGGCGGCGACCCCGACCG
CCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACGCGCCGCAACCCCGCCGCG
CACCGGATTCTGACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCGCGGCGACGTGGCTGCACG
CGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCCGGCGGCGGCCTCGCGCTCCTCACGTCCGGCAA
CAAGTTCGATTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAGTGCTCGGTGTCGATGGGC
GGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGAACTTCCTGACCACGCTGC
AGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGACATTCGAGATCAACGACAGCGCGTCGACGCTGCT
GCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGGCAGGACGCATCCGCGCTG
CTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCGTGTCGGGCCTCGCGAACG
CCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCGCGGTTGCCGATCTGCCGTGGGCGGG
CTTCGGCATATCCGCCGCGCAGTTCGCCGGCGCGAGCGCCGTCAGCACGGCGCTGATGGCGACGGCGCGC
ACGCTGCTCGCGAACGTCGCGAAGCTGCAGGAGGCGCTGCCGCTCGTCGCCGACCTGTCGCTCGGCAAGC
ACGGCATCGCCCTCGCCGCGAAGAACCTCACGCACGCGACGCGAATGTCGCTCGCCGTCGACGGGCTCAC
GTGGTCGACGCACGCGAAGGGGCCGGGCGCGGCGGGCGTCGCGATGAGCGCCGGCAAGGGCCGCTGGGGC
GTCGAATCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCGCGGTGCCGGCCGATCCGG
CCACCAGGCTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGATGCCTGCGTGAAGGACATCGC
CGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCCGTCAGAACGCGTTCGGCGTCAGCGCG
CTCGTGCCCACGCCGCCGTCGCCCGCCGATGCGGTCGCGGCGGTCGCGATCAAGGCGAAGGAAGCGAAGC
TCGCCGGGCTGAACGCGAAGCACAGGCTCGTCGCGCTGAAGATCGACAACCTCCAGCAAAAGCTCGAGAA
ACACGTGAATAACCTGAGCGCCGTGCGGATGAGCGCATCCGACGCCCAGCTCGGCTTCAAGGGCCACCGG
CTTGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGAAGCTCGACGTGCGCGAGG
CGAAGATCGGCGTCGTGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAAGATCGCGGCCGGTTGCGG
CAGCGCATCGCTCAAGCTCGGCAGCGACGGCGCGATCGACGTGCGCGCGACCAACGTCAAGCTGAACGGC
AGCGCGTCGCTGAAATTCGACGGCCAGTTGATCCAGCTCGGCTGA
 Primer design