SecReT6
Protein ID: 488607260
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5360
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2187624..2189306 [+]
Producttype IV/VI secretion system, DotU family domain protein
NoteTssL
UniProt IDN0AU38
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-43, Aligned region: 119..314
OmpA [PF00691], Evalue: 7.60E-10, Aligned region: 373..480
Protein Sequence: 560 a.a.     [Download]
>gi|488607260|ref|YP_007921800.1| type IV/VI secretion system, DotU family domain protein [Burkholderia thailandensis MSMB121]
MLDRAAANPDLATRIPTLSSLSSAAMSSSAVSTAGTTNVAASGAAASVAGSAAADAPPHADGSPRNPAVL
QFPVPGGAHAPADARGAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAI
RTQLGLEVRLYRERLAGSGCEWEQIRDASYLLCTYLDETVNDSAREHSQVVYDGERSLLVEFHDDAWGGE
DAFADLSRWMKADQPPVPLLSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTELV
TPAKRRRSWWTAGRAAAVALGVLVLAYGAISLWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILT
EGWLTAYKHPQGWLLVFKSDGAFDVGKAKVRPDFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSEFPD
NQALSEARARTVADELRTTALPGGARAPENAVQRSIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWKVIP
DGASQPGRSLNLQQPEKPGQVPMRPAMPEGVEIAPEGQLPYATTEITTATPTTMPATTQATRPTTEGRQP
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2187624-2189306 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGCGACGCGGATACCGACGCTGTCGTCGCTGTCCAGCG
CGGCGATGTCGAGCTCCGCCGTGTCGACCGCCGGCACGACGAACGTGGCTGCGTCGGGCGCCGCCGCGTC
GGTGGCCGGATCCGCGGCCGCGGACGCGCCGCCGCATGCCGACGGCTCGCCGCGCAATCCGGCGGTGCTG
CAGTTTCCGGTGCCGGGCGGCGCGCACGCACCCGCCGACGCGCGGGGCGCGGCGCCCGTCGTCTACAGCG
CGCAGGGCGAGCAGGCCGCGATCATGAAGGCGGGCCTGCAGCAGGCGAGCTGGAACAACCCGTTCGTGTC
GCACGCGTTGCCCGCGGTGCTGCAATTGCAGCGGCATCTCGCGGCCGGGCCGCTCAATCAGGCCGCGATC
CGCACGCAGCTCGGGCTCGAAGTGCGGCTCTACCGCGAGCGGCTCGCCGGCTCCGGCTGCGAATGGGAAC
AGATCCGCGATGCGTCGTACCTGCTGTGCACGTATCTCGACGAGACCGTCAACGATTCGGCGCGCGAGCA
TTCGCAGGTCGTCTATGACGGCGAGCGCAGCCTGCTCGTCGAGTTCCATGATGACGCATGGGGCGGCGAG
GACGCGTTCGCCGACCTGTCGCGCTGGATGAAGGCGGACCAGCCGCCGGTTCCGCTTCTCTCGTTCTACG
AACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGATCGCGGCGACGTGCTGTTGCAGGA
CCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACCGAGCTCGTC
ACGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGCCGCGCGGCGGCCGTCGCGCTCGGCGTGCTCG
TGCTCGCGTACGGCGCGATCAGCCTCTGGCTCGATTCGCAGGGGCGGCCGATCCGCAACGCGCTCGCCGC
GTGGATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAGATCCTCACG
GAAGGATGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACGGCGCGTTCG
ACGTCGGCAAGGCGAAGGTCCGGCCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGCGTTCGCGCC
GTGGCCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAGTTCCCGGAC
AACCAGGCGCTGTCGGAAGCGCGGGCGCGCACCGTCGCCGACGAACTGCGCACGACCGCGCTGCCGGGCG
GCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAGCATCGAGTATTCGGGGCGCGGCGACGCGCAGCCGAT
CGACACCGCGAAGACGGCCGCCGCTTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAGGTGATTCCC
GACGGCGCGTCGCAACCGGGCCGCAGCCTGAATCTGCAGCAGCCGGAGAAGCCCGGCCAGGTCCCGATGC
GTCCGGCGATGCCGGAAGGCGTCGAGATCGCGCCTGAAGGGCAACTGCCGTATGCGACGACGGAAATCAC
GACCGCGACGCCAACCACGATGCCAGCAACGACGCAAGCGACGAGACCGACCACGGAGGGCCGTCAGCCA
TGA
 Primer design