SecReT6
Protein ID: 488607318
SecReT6 ID759
T6SS typei1
Gene symbol-
Locus tagBTI_3987
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]458874..459896 [+]
Producthypothetical protein
NoteTssG
UniProt IDN0ALJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-77, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|488607318|ref|YP_007920448.1| hypothetical protein BTI_3987 [Burkholderia thailandensis MSMB121]
MPALEPVLLGEAKHFAYFQAIRLLRRIVRERRDAAACRPDARMPIHTRPNLALSFPDTDIERIDKAEDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFKGRHAARSFLDVLHRALYPLLFDAWLKHRLSLRIVEERDE
NALRPLYALAGVDARVARDAGLHAHALLRYVGLLSQRPRSASGLRALLADAFAPATVDIEPCVPQWLPIP
GNQRTRVGARAHRLGVDARVGTHMRDDGARLRIVLGDVPGPLFRALMPGGEAFRRLRFLARLYLTQPFTV
DVVVRVRARDALPARCGGRAWSRVGLDAWLGGPAPQRAASPEFRLPPSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|488605303|ref|NC_021174.1|:458874-459896 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCCTGCTCTAGAACCCGTGCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGTCCGCGAACGGCGCGACGCGGCCGCGTGCAGGCCCGACGCGCGGATGCCGATCCACAC
GCGGCCGAATCTCGCGCTGTCGTTTCCGGACACCGACATCGAGCGCATCGACAAGGCGGAGGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGGCTGTACGGCGTGTCGTCGCCGCTGCCGACGTTCTATACCGAAG
ACCTGATCGACGAAGCGTTCAAGGGCCGCCACGCGGCGCGCAGCTTCCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGATGCCTGGCTCAAGCATCGGCTGTCGCTGCGGATCGTCGAGGAGCGCGACGAG
AACGCGCTGCGCCCGCTCTACGCGCTCGCGGGCGTCGATGCGCGCGTCGCGCGCGACGCGGGCCTGCACG
CGCACGCGCTGCTGCGCTACGTCGGGCTGCTGAGCCAGCGGCCGCGCTCGGCGTCCGGGCTGCGCGCGCT
GCTCGCCGATGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGCCGCAGTGGCTGCCGATTCCC
GGCAATCAGCGCACCCGCGTCGGCGCGCGCGCGCATCGGCTCGGCGTCGACGCGCGCGTCGGCACGCACA
TGCGCGACGACGGCGCCCGGTTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGAAGCGTTCCGCCGGCTCCGGTTCCTCGCGCGTCTCTATCTGACGCAACCGTTCACAGTC
GACGTCGTGGTCCGCGTGCGCGCGCGCGACGCGCTGCCCGCGCGCTGCGGCGGCCGCGCATGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGGCCGGCGCCCCAACGCGCGGCGTCGCCCGAATTCCGTCTTCCGCC
CTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA
 Primer design