SecReT6
Protein ID: 488607333
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5358
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2185602..2186183 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDN0ALK2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-12, Aligned region: 15..150
Protein Sequence: 193 a.a.     [Download]
>gi|488607333|ref|YP_007921798.1| type VI secretion lipofamily protein [Burkholderia thailandensis MSMB121]
MGPFKSFAAALALGMLAGCSMFSSSKPEEPRQLHVTLVGGNRLNVAPTGEPRPVQTCVYVVTAADWLPTQ
GGDDSSCASRGQDSTVVADSRHVVAPNQVLQFSLNLPRSGDLWLVADADYARRPTNYGPLRVRIEGRGLI
HMAVWLDRDGIYNALLPGPVPVGGALAASAVHTDEPPPERRTKTTYGTRRSRQ
 
Nucleotide Sequence: 582 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2185602-2186183 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGGCCCCTTCAAATCATTCGCGGCGGCGCTCGCGCTCGGCATGCTCGCCGGCTGCTCGATGTTCTCGT
CGTCGAAGCCGGAAGAGCCGCGGCAACTGCACGTGACGCTCGTCGGCGGCAACCGGCTGAACGTCGCGCC
GACGGGCGAGCCGCGGCCGGTGCAGACGTGCGTGTACGTCGTGACCGCGGCCGACTGGCTGCCGACGCAA
GGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACTCGCGCCACGTGG
TCGCGCCGAACCAGGTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGTGACCTGTGGCTCGTCGCCGA
CGCCGACTACGCGCGCCGGCCGACGAACTACGGGCCGCTGCGCGTGCGCATCGAGGGCCGCGGATTGATT
CACATGGCCGTCTGGCTCGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCTGTGCCCGTCGGCG
GCGCGCTCGCCGCATCGGCGGTCCACACCGACGAGCCGCCGCCCGAGCGCAGGACGAAAACCACCTATGG
GACAAGGAGAAGCAGGCAATGA
 Primer design