SecReT6
Protein ID: 488607407
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4923
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1652141..1654345 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDN0ANJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-85, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 1.20E-85, Aligned region: 537..577
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 573..594
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 634..643
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 8.00E-07, Aligned region: 715..727
DUF2345 [PF10106], Evalue: 0.0053, Aligned region: 494..532
DUF2345 [PF10106], Evalue: 0.0053, Aligned region: 661..713
Protein Sequence: 734 a.a.     [Download]
>gi|488607407|ref|YP_007921370.1| Rhs element Vgr family protein [Burkholderia thailandensis MSMB121]
MTRVFTLDSLHGDDLKFHQLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESARYLNGI
VARASLVGRRAERHYGYQLIVRPWMWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTETYTPREY
CVQYNETDAAFVSRLMEFEGIYYYFRHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDSFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVAHESQVLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNETMSVANNRQRSVGQNETVNIGKHRVAQIGGNETH
GVVGNRTRQVGKDETVTIGANREATIGGNHVETVTKDKTESIGEGKTLNVTKHYQTNSKSMKTAVIEHHA
EEIGSRTSTIKNAHVLNVGDSQSVNVGASHTMSVKNNVHVGAGDEIALVCGDASITLKKDGTIVINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1652141-1654345 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGAGACGACCTGAAGTTTCACCAGCTCTACGGCGAGG
AAGCGCTCGGGCGAATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
GCTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGCGCGCTATCTGAACGGCATC
GTCGCGCGCGCGTCGCTCGTCGGGCGGCGCGCGGAGCGGCACTACGGCTACCAGTTGATCGTGCGCCCGT
GGATGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAGATCGTGCA
GGACGTGCTCGGCACGTATGGTTTCCCGATCGAAAACCATCTGACCGAGACGTACACGCCGCGCGAATAC
TGCGTGCAGTACAACGAAACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAGGCATGCGGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
CGGCTACGAGCATATTCCATTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGATAGC
TGGCTGCCCGCGCAGGAGGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGATCACGACAGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGACGAGCCGGGCGCGCATTACAGCCGCGTGCGGCTCGAGGAGCAGCAGGCCGAG
CACGAGCGCGCGCTCGCGCGCACCGACGTGCGCGGGATCGCGCCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCCTA
CGCGACCGACAGCGGCAACGAAGCGGTCGCGCACGAATCGCAGGTGCTCGTGCAGCCGTCGAGCCTGCCG
TACCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGTTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCAGGCGGCGGCTTCGGCGGCGTG
CAGATACCGCGCATCGGCGATGAGGTGGTGGTGGATTTCCTGAACGGCGACCCTGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCGTGGGGGCTGCCCGGCAGCGCGACGCAAAGCGGGCT
GCTCTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCATTTCGCTTCGAGGACAAGAAGGGC
GCGGAACAGTTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACCGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCATTCGCATTCGGTCGGCAACAACGAGACGATGAGCGTCGCGAACAACCGGCAAAGGAG
TGTCGGGCAGAACGAGACAGTGAACATCGGGAAGCATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGTCGGCAATCGCACGCGGCAGGTCGGAAAAGACGAAACCGTGACCATCGGCGCGAATCGAGAAG
CGACGATCGGCGGCAATCACGTGGAGACAGTGACGAAAGACAAGACCGAATCGATCGGAGAGGGCAAGAC
GCTGAACGTCACCAAGCACTACCAGACGAATTCGAAAAGCATGAAGACCGCCGTCATCGAGCATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCAAGAACGCGCACGTGCTCAACGTCGGCGATTCGCAATCGG
TGAACGTCGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTGCATGTCGGCGCGGGCGATGAAATCGC
ACTTGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGTGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCACAGCGTGCGCGGCAAGACGGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA
 Primer design