SecReT6
Protein ID: 488607428
SecReT6 ID762
T6SS typei3
Gene symbol-
Locus tagBTI_5347
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]2169728..2170255 [+]
Producthypothetical protein
NoteTssD
UniProt IDN0ALS3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|488607428|ref|YP_007921787.1| hypothetical protein BTI_5347 [Burkholderia thailandensis MSMB121]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|488605303|ref|NC_021174.1|:2169728-2170255 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGGCAAATGCGTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGCGAGTCGACCGATCAGCAAT
ACCCCGGCCTGATCCAGATTCAGAGCTGGCAGTGGGCGGAAGAGAACTCCGGCCGTTGGGGCTTCGGCAG
CGGCGGCGGCGCAGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCTTCGCCG
AAGCTGTTCCTGATGTGTGCGACGGGCGAGCACATTCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAATTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATTTCGCAGCTCGGCCACGCCAGCGGCGAAGTCGACGGCGTGCTGCCGACCGACCAGATCCGG
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCGGTGATCA
AGGCCGGATACGACCTCAAGCAGAACGCCCCGATCTAA
 Primer design