SecReT6
Protein ID: 488607452
SecReT6 ID761
T6SS typei3
Gene symbol-
Locus tagBTI_4921
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1648245..1649474 [+]
Producthypothetical protein
NoteTssG
UniProt IDN0ANM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-128, Aligned region: 49..357
Protein Sequence: 409 a.a.     [Download]
>gi|488607452|ref|YP_007921368.1| hypothetical protein BTI_4921 [Burkholderia thailandensis MSMB121]
MTTHPKPEPAATDVRADSNVDEGAAPRADLNAAPHADAARRDAWWRRLRAAPHGYDLFHALRWLDALSPE
HAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGPHPRVAIHGFGLFGPNGPLPSHLTEYAYERATQ
HDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPARARFDRYVASLIGPRDAPSPDADASDSAGVLA
PHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPQWVMLERAQRCAIRATRPTQPLGSAVLGYA
VRDAQSRLRIVLGPLTLDEYRQFLPGGAHARRLAQWVREYVGIEFDWDVQLELAHDEVPALALGGRHGLG
RTAWLGERLDPGPAHDLVLGYDARALHARGGGASADAARVRSTAADQAAAADALDRQPA
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|488605303|ref|NC_021174.1|:1648245-1649474 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGACGACGCATCCGAAACCGGAGCCGGCCGCGACGGACGTGCGCGCGGACTCGAACGTGGACGAGGGCG
CGGCTCCGCGTGCGGATCTGAACGCAGCGCCGCATGCCGACGCCGCGCGCCGCGACGCCTGGTGGCGCCG
CCTGCGCGCCGCGCCGCACGGCTACGATCTGTTCCATGCGCTGCGCTGGCTCGATGCGCTGTCGCCGGAG
CACGCGCCGTCCGGCTATGCGTCGCGGCCGCGCGACGAGCCGGTGCGGTTCGGCCAGGCGCCGTCGCTCG
CGTTCGCGGCGGCGATGCTCGCCGACGTGCGCGACGACGGCCCGCATCCGCGCGTCGCGATTCACGGCTT
CGGATTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCGAGTACGCGTATGAGCGCGCGACGCAG
CACGACGATCCGACGTTCGCCGCGTTCGCCGACCTGTTCCATCATCGGCTGATCCTGCTGTTCTATCGCG
CGTGGGCCGACGCGCAGCCGACCGTCAGCCTCGACCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTCGC
GAGCCTGATCGGGCCGCGCGACGCGCCCTCGCCCGATGCCGACGCGTCAGACAGCGCCGGCGTGCTCGCG
CCGCATGCGAAGTATCACCAGGCGGGCCATCTGGTGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGA
TCCTGCGGCGCTACTTCGGCGTGCGGGTGCGTATCGTCGAACACGTGCCGCAATGGGTGATGCTCGAGCG
CGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACACAGCCGCTCGGCAGCGCCGTGCTCGGCTATGCG
GTGCGCGACGCGCAATCGCGCTTGCGGATTGTGCTCGGCCCGCTGACGCTCGACGAATACCGGCAGTTCC
TGCCGGGCGGCGCGCACGCGCGGCGGCTCGCGCAATGGGTGCGCGAGTACGTCGGCATCGAATTCGACTG
GGACGTGCAGCTCGAGCTCGCGCACGACGAAGTGCCGGCGCTCGCGCTCGGCGGCCGTCACGGGCTCGGC
CGCACCGCGTGGCTCGGCGAGCGGCTCGATCCCGGCCCCGCGCACGATCTCGTGCTCGGCTACGACGCGC
GCGCGCTCCATGCGCGCGGCGGGGGGGCGAGCGCGGACGCCGCGCGCGTTCGATCGACCGCGGCCGATCA
GGCGGCCGCCGCCGACGCGCTTGATCGACAACCTGCCTGA
 Primer design